Story cover for Pranking Mr. Unknown by svenfif
Pranking Mr. Unknown
svenfif
  • WpView
    MGA BUMASA 44
  • WpVote
    Mga Boto 7
  • WpPart
    Mga Parte 2
  • WpView
    MGA BUMASA 44
  • WpVote
    Mga Boto 7
  • WpPart
    Mga Parte 2
svenfif
Ongoing, Unang na-publish Mar 25, 2022
Mature
ionperezmentalicsromcomshowtimefamtripletsvicegandaviceion
A gay who is bored and tried to prank some unknown person. 

"I want to prank someone who don't know me, so it's not embarrassing when it fails." Vice said


Paalala⚠️
Grammatical errors ahead
Good and Bad comments are accepted
Public Domain
ionperezmentalicsromcomshowtimefamtripletsvicegandaviceion
Table of contents

2 parte

Sign up to add Pranking Mr. Unknown to your library and receive updates
o
Mga Alituntunin ng Nilalaman
Magugustuhan mo rin ang
Ikaw at Ako (COMPLETED) ni miss_kaexe
56 mga parte Kumpleto Mature
Love comes in wrong or good way but for Vice Ganda, it comes in a unexpected moment. Meeting the greatest man of his life became such a wondrous moment. She never expected this way. A love who'll conquer everything, even it's greatest problem is to love her. In the end, it doesn't matter who it is. It's the love.
The Boss and Her Beki Husband ni YooAckerman
30 parte Kumpleto
A gay can fall in love too... with a girl.
ᴜɴғᴏʀɢᴇᴛᴛᴀʙʟᴇ ʟᴏᴠᴇ ni mochie_kun
43 parte Kumpleto Mature
ᴅᴏ ʏᴏᴜ ʙᴇʟɪᴇᴠᴇ ɪɴ ʟᴏᴠᴇ ᴀᴛ ғɪʀsᴛ sɪɢʜᴛ? ɪᴛᴏ ᴀɴɢ ᴜɴᴀɴɢ ɴᴀʀᴀᴍᴅᴀᴍᴀɴ ɴɪ ɢᴀᴠɪɴ ᴋᴀʏ ʏᴜʀɪ ɴɢ ᴜɴᴀɴɢ ʙᴇsᴇs ɴᴀ ᴍᴀɢ ᴄʀᴏss ᴀɴɢ ʟᴀɴᴅᴀs ɴɪʟᴀ... ʏᴇᴀʀs ᴀғᴛᴇʀ ʜɪɴᴅɪ ᴘᴀ ᴅɪɴ ɴᴀᴡᴀʟᴀ ᴀɴɢ ɴᴀʀᴀʀᴀᴍᴅᴀᴍᴀɴ ɴʏᴀ ɢɪɴᴀᴡᴀ ɴʏᴀ ᴀɴɢ ʟᴀʜᴀᴛ ᴘᴀʀᴀ ᴍᴀᴘᴀɴsɪɴ sʏᴀ ɴɢ ᴜʟᴛɪᴍᴀᴛᴇ ᴄʀᴜsʜ ɴʏᴀ ᴍᴀʜᴀʜᴀɴᴀᴘ ɴɢᴀ ᴋᴀʏᴀ ɴɪ ɢᴀᴠɪɴ ᴀɴɢ ᴛᴜɴᴀʏ ɴᴀ ᴋᴀʟɪɢᴀyᴀʜᴀɴ ɢᴀʏᴏɴɢ ʜɪɴᴅɪ ɴᴀɢᴘᴀᴘᴀᴋɪᴛᴀ ɴɢ ɪɴᴛᴇʀᴇsᴛ sɪ ʏᴜʀɪ sᴀ ᴋᴀɴʏᴀ? ᴡɪʟʟ ʜɪs ᴏɴᴇ sɪᴅᴇᴅ ʟᴏᴠᴇ ғɪɴᴅ ᴛʜᴇ ʜᴀᴘᴘʏ ᴇɴᴅɪɴɢ ʜᴇ ᴡᴀɴᴛ???
Just PRETENDING ni HermesTheTrickster
34 mga parte Kumpleto
"Someone said to me that It's hard to pretend you love someone when you don't. But its harder to pretend you don't love someone when you really do." "Then stop Pretending. Because right now I don't know what's real anymore" . . Yung feeling na gusto mong bigyan ng Oscar Award lahat ng taong naka paligid sayo. GxG Open Minded only XD Warning:Wrong grammar and Spelling ahead
MY BOSS ni thewriter_xela
60 parte Ongoing Mature
Vice Ganda built walls-high, cold, unbreakable. Then Ion Perez walked in. With the kind of smile that feels like morning light, And a laugh that lingers longer than it should. He was just an assistant. Until he became the only thing Vice couldn't control. In a world full of deadlines and distance, What happens when love finds a way in?
•Can We Comeback Again• VICEION ni orenspenk102518
63 parte Kumpleto
Napapagod den ako! I'm sorry... Please ayusin natin to.. ayoko na! Mahal kita pero pinapalaya na kita.. Wag please Malaya ka na •••••••••••••••••••••••••••••••••••••••••••••••••••••••••••••••••••••••••••••• Enjoy..
Destined Amorous Lovers (Under Revision) ni serineriaserenade
55 parte Kumpleto
When two people are meant to be, no time is too long, no distance is too far, and nobody can keep them apart.
"me meto al whatsapp de mis viewers" [rodrivan] ni luvsprn
17 parte Kumpleto
➳ ❨ ✦ ❩ Donde Rodrigo sin querer doxea una conversación de su whatsapp... ⠀⠀⠀⠀ ⠀┏━━━━━━━❈✦❀✦❈━━━━━━━┓ ⠀⠀⠀⠀ ╰✧ historia original, prohibidas las ⠀⠀⠀⠀ ⠀⠀⠀⠀ ⠀⠀ adaptaciones sin permiso ⠀⠀⠀⠀ ╰✧ contenido sexual +18 ⠀⠀⠀⠀ ╰✧ spreen: activo // carre: pasivo ⠀⠀⠀⠀ ╰✧ fecha de inicio: 24/04/2023 ⠀⠀⠀⠀ ╰✧ fecha de finalización: 05/06/2023 ⠀┗━━━━━━━❈✦❀✦❈━━━━━━━┛ ⚠︎ no busco asumir la sexualidad de ningún streamer, es una historia para entretener y no será borrada a menos que alguno de los involucrados lo pida. ⠀⠀⠀⠀ ⠀⠀⠀⠀ ⠀⠀⠀⠀ ⠀⠀⠀⠀ ⠀⠀⠀⠀ © LUVSPRN ⠀⠀⠀⠀ ⠀⠀⠀⠀ ⠀⠀⠀
I'm The Mafia's Man(BxB Series#1✔) ni Sinfulsleeper
33 parte Kumpleto Mature
WARNING: This contains matured scenes not suitable for very young audiences. Read at your own risk. R+18
Magugustuhan mo rin ang
Slide 1 of 9
Ikaw at Ako (COMPLETED) cover
The Boss and Her Beki Husband cover
ᴜɴғᴏʀɢᴇᴛᴛᴀʙʟᴇ ʟᴏᴠᴇ cover
Just PRETENDING cover
MY BOSS cover
•Can We Comeback Again• VICEION cover
Destined Amorous Lovers (Under Revision) cover
"me meto al whatsapp de mis viewers" [rodrivan] cover
I'm The Mafia's Man(BxB Series#1✔) cover

Ikaw at Ako (COMPLETED)

56 mga parte Kumpleto Mature

Love comes in wrong or good way but for Vice Ganda, it comes in a unexpected moment. Meeting the greatest man of his life became such a wondrous moment. She never expected this way. A love who'll conquer everything, even it's greatest problem is to love her. In the end, it doesn't matter who it is. It's the love.

Karagdagang detalye