With Me | (An Assassin's Creed Story)
Aacreed
  • Reads 2,446
  • Votes 139
  • Parts 18
  • Time 1h 40m
  • Reads 2,446
  • Votes 139
  • Parts 18
  • Time 1h 40m
Aacreed
Ongoing, First published Apr 07, 2022
Mature
actionaltairarnodorianassassinassassinsassassinscreedconnorkenwaydramaedwardkenwayeviefryeezioauditorefanfictionjacobfryelovemultiverseromanceromancefanfictiontemplarsvideogames
What happens when universes and time slowly collide and assassins from different eras all meet up in one location? 

Will they be able to defeat the threat growing over Victorian London?
Or will it fall into enemy hands?

That's for you to discover.


A story by: Aacreed

And don't forget, "Nothing is true, everything is permitted."
All Rights Reserved
actionaltairarnodorianassassinassassinsassassinscreedconnorkenwaydramaedwardkenwayeviefryeezioauditorefanfictionjacobfryelovemultiverseromanceromancefanfictiontemplarsvideogames
Table of contents

18 parts

Sign up to add With Me | (An Assassin's Creed Story) to your library and receive updates
or
Content Guidelines
You may also like
Assassin's Creed : Reunited (COMPLETED) by DianacClenin
22 parts Complete Mature
Read this story at your own peril(it's so bad) (It is a Reader X Edward fanfic, sorry if anything isn't like the character, I tried my best) Camilla, the most trusted Italian assassin, reunites all assassins at once, thinking he would be a help, for only to Ezio finding out her true purpose in this establishment. A mystery visitor is over staying her welcome by taking over. Only to uncover what has been happening. Will these assassins be able to put up with the pressure? Or separate forever? @Copyright 2013
Everything is Due ; Nothing is submitted by hope_h1999
40 parts Complete
Evie and Jacob just moved across the Atlantic to Davenport University to start their Freshmen year. Will they be able to survive with crazy roommates, professors, classes, and even a secret society? Altair ,Malik, Ezio, Conner, and Desmond are the RAs of the dormitory Homestead will they be able to control residents and maintain peace while running one of the best frats on campus that may or may not be a secret organization? Read as our favorites Assassins navigate life, love and classes in this university inspired fic. This will be more centered on the Frye twins but a bunch of characters will be making appearances. This fic will update every Sunday!
London's Call by winterkonijn1
26 parts Complete Mature
London has fallen to the Templars. Their rule has been so long that it has been more than a hundred years since the Assassins were driven out of the city. The rule of the Templar began to be threatened when the Frye twins come to Londen. Evie Frye along with Jacob come to London the get rid of the Templars and give the city back to the people. In that goal they come across more than just allies. At least, that is true for Evie Frye. In her search she does not only find the piece of Eden, but also a person she thought she never would meet. ~ I do not own Assassin's Creed Syndicate plot or characters. Only my own ideas and characters. ~ This story is a Evie Frye romance with a female character made by me. Inspired by the game itself and by Graceful_panda. Mature content, read at your own discretion.
Coldhearted Assassin (Revising/Highly Unedited) by xCourtofDreamersx
34 parts Complete Mature
#1 in Altair **Previously known as...Coldhearted Assassin Love** Assassin's Creed Fanfiction Kalila, a young Arabian noblewoman. She knows how to defend herself with a blade after losing her parents to a group of Templars at a young age. She has no siblings as she travels from one city to another looking for Templars to avenge her parent's death and to find something more than she was expecting. She comes across information about a certain group of Templars that were the ones responsible for her parent's death. She begins to learn about secrets that have been untouched. She begins her journey to become something more than she already is. She meets an Assassin that goes by the name of Altair. Altair was on the mission to dispose of these Templar's that have been advancing and becoming a threat that he needs to stop. They're also recruiting people into their organization. He has been ordered to stop them, just like every other Assassin. He was on his way to kill a Templar when he ran into a mysterious woman name Kalila. She reminds him of someone he used to love very deeply and he doesn't know what to do with her, but find out why. He despises the fact that she looks like the person that he had deeply loved and begins to hate her with a passion, but she doesn't like him either. In fact, she despises him for a multiple of things. Opposite can attract... (Going Under Editing)
Assassin's Creed: Gang Leaders |Assassin's Creed Fanfiction| by PineWatch
39 parts Complete
Crawford Starrick is taking over London, slowly but surely. Jacob and Evie are assassins, recently arrived in London. It doesn't take them long to find two other assassins from a different part of the world, and two from London. Can they save the city, and the Piece of Eden? ---------------------------- Another AC fanfiction! This one is based on Assassin's Creed Syndicate. If you read Assassin's Creed: Brothers Unite, you'll know that Archer and Arno promised to return. Well they do! Hope you enjoy it!
𝑺𝒐𝒖𝒍𝒎𝒂𝒕𝒆 𝑨𝑼𝒔 || 🥀 by hiragiss
58 parts Complete
[no longer taking requests/updates] [status: completed] (2018-2021) A collection of 'Soulmate AU' ideas, prompts, etc. (+soulmate theories/myths) that I've found through my hours of pinterest scrolling and web diving. Feel free to use any of these AUs in your stories; it's what they're solely for anyway. Just be sure to give proper credit where it is due ✖️REMINDER✖️ Most of these AUs are NOT my ideas unless I say otherwise. Most of these belong to the tumblr, insta, tiktok, and wattpad users in each original post! One more thing- you don't have to ask me for permission to use my AUs. Credit to me is not mandatory either. Thank you cover manga: orange
Test of Faith by KeanaCalandrino3
84 parts Complete
It was strange. No one seemed to have any knowledge of who they were, and those who did - the very few - refused to speak of them. Some feigned knowledge of them and attempted to spew lies, and they received the consequences they deserved. Time was of the essence, and yet the last piece that was needed seemed to have been lost to the ages. It was very strange, indeed....
Twisted Creed by ChocoFresa
34 parts Complete Mature
This is my Assassin's Creed: Syndicate (Personal Fanfiction) I do not own the Assassin's Creed character's "Nothing is true, everything is permitted" - Assassin's Creed. 100 years have the Templar's keep their domain in London. It is time to bring Crawford & his Templar's down, that was the idea, the Frye twins had. Will their plan be interrupted by the new twist of fate? Rosaliana Von Shrieder has returned to London. After a long time of being gone, she has been called to the House of Templars. Will she betray her own beliefs? This is my original fan fiction crossover. I do own my own original characters :D
The Alliance | Jacob Frye by llittlemisswriterr
22 parts Ongoing Mature
The year is 1868 and the Templar domain in London is as strong as it's ever been. The Order has held its power over the city for hundreds of years, but the new age of the Industrial Revolution brings on inevitable change to the economy. Returning to London after many years, Lily Harvard comes to a harsh realization that the city had taken a turn for the worst. Overturning power would be nothing less than a war, but her goal had been simple. Take back control from the Templars. However, in the midst of her mission comes unexpected challenges for the young assassin. Newly formed alliances, painful recollection of her past, and a reckless man by the name of Jacob Frye. Will her efforts be enough to free London? - Jacob Frye x Lily Harvard (OC).
The Assassin Bureau: Imagines and Preferences by 80kumagai
29 parts Complete
Just a gathering of short stories/one shots that I'm slowly creating Warnings: violence, smut, angst
You may also like
Slide 1 of 10
Assassin's Creed : Reunited (COMPLETED) cover
Everything is Due ; Nothing is submitted cover
London's Call cover
Coldhearted Assassin (Revising/Highly Unedited) cover
Assassin's Creed: Gang Leaders |Assassin's Creed Fanfiction| cover
𝑺𝒐𝒖𝒍𝒎𝒂𝒕𝒆 𝑨𝑼𝒔 || 🥀 cover
Test of Faith cover
Twisted Creed cover
The Alliance | Jacob Frye cover
The Assassin Bureau: Imagines and Preferences cover

Assassin's Creed : Reunited (COMPLETED)

22 parts Complete Mature

Read this story at your own peril(it's so bad) (It is a Reader X Edward fanfic, sorry if anything isn't like the character, I tried my best) Camilla, the most trusted Italian assassin, reunites all assassins at once, thinking he would be a help, for only to Ezio finding out her true purpose in this establishment. A mystery visitor is over staying her welcome by taking over. Only to uncover what has been happening. Will these assassins be able to put up with the pressure? Or separate forever? @Copyright 2013

More details