My Trouble Of Love
mafia_chips
  • Reads 322
  • Votes 7
  • Parts 8
  • Time 51m
  • Reads 322
  • Votes 7
  • Parts 8
  • Time 51m
mafia_chips
Ongoing, First published Apr 19, 2022
Mature
agegapassassinbabybadassbadboybadgirlbillionairebosscheatingdaddyfamilykidnappedlovemafiamafiaprincessmafiaqueenmobolderbrothersarcasmspanishspanishmafiatroubleundergroundweponsyoungerbrother
Diana Lopez, a girl who has a troubled life. Lilith, a girl who is in trouble. The only thing these two have in common is that they are the same girl with different titles. Diana the meaning of daylight and heavenly. Lilith the meaning of devil and demon. She is strong and a powerful woman who ran the underground as an assassin named Lilith. What happened when Diana finally had enough of dealing with her troubled life and decided she wants a love life ?
All Rights Reserved
agegapassassinbabybadassbadboybadgirlbillionairebosscheatingdaddyfamilykidnappedlovemafiamafiaprincessmafiaqueenmobolderbrothersarcasmspanishspanishmafiatroubleundergroundweponsyoungerbrother
Table of contents

8 parts

Sign up to add My Trouble Of Love to your library and receive updates
or
Content Guidelines
You may also like
The Assassin and the Gang✔️ by urdarlingbae
44 parts Complete Mature
Lilith is bad bitch, but she is one of the nicest people ever as well. She is sweet, likes to go shopping, loves food, and especially pancakes. And she kills people for a living. "Princess? Bitch, I'm a queen." Steel is a gang leader, and thought everyone was beneath him. He was a cold blooded asshole, but that wouldn't stop him from getting what he wanted. What happens when Lilith goes to same school as Steel? Will she be able to stop herself from kicking his ass, or will she be the one begging for mercy instead? There is always more at play then what meets the eye. And Steel doesn't always realize that. Lilith has to make allies and friends, to be able to bring the people who took everything from her down. "I wanted her so badly. I just needed to know how to get her. Lilith. It was such a glamorous name. And it sounded so sweet. " ~ ✨THIS IS NOT A CLICHE✨ ALL RIGHTS GO TO ME ISTG IF YOU GUYS STEAL MY IDEA IMMA RIOT- ~
The Only Queen by ladyrose_thewriter
38 parts Complete Mature
[MAFIA ROMANCE, RATED R] "I catch a lot of attention these days," she purred, her voice dripping with seductive allure as she toyed with Cedric's expectations. "But you haven't quite managed to capture mine yet," she teased, her tone coy yet tantalizing. Cedric's expression darkened slightly, a predatory gleam in his eyes as he stepped closer to Lilith, the air charged with electricity between them. "I always get what I want, when I want," he growled softly, his voice low and commanding as he locked eyes with her. ~ In the heart of the male-dominated underworld, Lilith emerges as a formidable force, crowned as the sole queen among her four brothers. It's a destiny written before her birth, a path she must walk to uphold her family's legacy. Tasked by her oldest brother, Lucifer, with using her feminine charm to navigate the treacherous world of organized crime, Lilith finds herself entangled in a web of intrigue, unaware of the intricate game Lucifer is playing. Sin City is akin to hell itself, a domain where Lucifer holds sway, and Lilith is destined to become the Queen of Hell. As Lilith embraces her role, her journey collides with Cedric, an ambitious underworld king ruling the streets of New York. Cedric is determined to make Lilith his queen, regardless of the consequences. Their meeting ignites a fierce clash of wills and desires, propelling them into a whirlwind adventure through the dangerous streets of Sin City and New York. Bound by duty to fulfill her family's legacy by producing an heir, and Cedric's need for a queen to reign over New York, their attraction becomes undeniable. Yet, they must navigate the complexities of their forbidden love, determined to find a way to make it work against all odds, even as the powers of hell itself watch their every move.
Desire (18+) [Complete] by hazeltales
100 parts Complete Mature
[Complete] (Editing) Isabella Perez, from a mafia family, in search of a better start in life, runs away from her family and moves to New York for better opportunities. When everything was going as it should be, problems arise when she is kidnapped by a friend she recently made, when she realizes that she was kidnapped by the biggest mafia leader in the world. The Devil. Stuck up with her past and the problems which are going to arise in her future. Will she be able to cope with all of this? What will happen when she starts a new life away from her family and her past life?
MR AND MRS MAFIA by TheWalnutTree
80 parts Complete Mature
Alessia Ferrari is the Don of the Italian Mafia. Whip-smart and dangerous, she is a woman in a man's world, surviving against all odds. Born and raised to become a lethal killer, even the ground she walks on bows at her feet. She has it all, until that is, her father gives her hand away in marriage. Ace Hernandez is the boss of the American Mafia. He's a cold cruel hearted monster. He knows the game all too well and does whatever it takes to win and if that means breaking someone, he could do that with his eyes closed. Fate is vicious when the two are forced to marry. Will two monsters find solace in each other's arms or will they kill each other? ---------------------------- "I don't recall signing up for strip poker." She replied. Her full lips frowned softly but her eyes were filled with amusement. She knew she couldn't beat me, not at this game. "Are you quitting? Are you a quitter?" I mocked getting under her skin. Her lips twitched before she pursed them tightly. The blues of her eyes deepened and she threw me a dangerous smirk. She shuffled and pulled off one of her sandals. Fuck. So we're doing this the long way. She raised it in the air, dangling it off her finger before tossing it aside. She raised a brow at me, she challenged me. I knew I got under her skin. Just as I had anticipated. -------------------------- BE AWARE: Trigger warnings: MATURE CONTENT 18+ (SMUT) SWEARING VIOLENCE/GUN VIOLENCE SELF HARM/SUICIDE (REFERENCES) EXPLICIT LANGUAGE REFERENCES TO RAPE SMOKING/ALCOHOL/DRUGS BLOOD/DEATH/GORE ©️ All rights reserved ™️ The Walnut Tree BOOK ONE OF THE MAFIA SERIES
Clandestine | 18+ by Rosaliexreads
33 parts Ongoing Mature
𝐖𝐞 𝐚𝐫𝐞 𝐚𝐥𝐰𝐚𝐲𝐬 𝐭𝐨𝐥𝐝 𝐭𝐡𝐞𝐫𝐞 𝐢𝐬 𝐨𝐧𝐥𝐲 𝐨𝐧𝐞 𝐝𝐞𝐯𝐢𝐥. 𝐁𝐮𝐭 𝐰𝐡𝐚𝐭 𝐡𝐚𝐩𝐩𝐞𝐧𝐬 𝐰𝐡𝐞𝐧 𝐭𝐡𝐞𝐫𝐞 𝐚𝐫𝐞 𝐭𝐰𝐨 𝐢𝐧 𝐭𝐡𝐞 𝐬𝐚𝐦𝐞 𝐩𝐥𝐚𝐜𝐞 𝐰𝐚𝐢𝐭𝐢𝐧𝐠 𝐭𝐨 𝐝𝐞𝐬𝐭𝐫𝐨𝐲 𝐨𝐧𝐞 𝐚𝐧𝐨𝐭𝐡𝐞𝐫? _______________________ They say to fear the devil. They say to pray to god in hopes of keeping the devil away. But they don't know that the devil can hear their prayers too. They say there is only good and bad. They say there is both a devil and a god. But what happens when only the devil, two negatives of the same kind become one? Not knowing that the other is also a devil? She has a high pitched voice everyday. 𝑇𝑜 ℎ𝑖𝑑𝑒 ℎ𝑒𝑟 𝑟𝑢𝑡ℎ𝑙𝑒𝑠𝑠 𝑣𝑜𝑖𝑐𝑒 𝑠ℎ𝑜𝑤𝑛 𝑎𝑡 𝑛𝑖𝑔ℎ𝑡. He wears suits. 𝑇𝑜 ℎ𝑖𝑑𝑒 ℎ𝑖𝑠 𝑏𝑙𝑜𝑜𝑑. She's famous to the world because of her dad. 𝑆ℎ𝑒'𝑠 𝑓𝑎𝑚𝑜𝑢𝑠 𝑖𝑛 𝑡ℎ𝑒 𝑢𝑛𝑑𝑒𝑟𝑤𝑜𝑟𝑙𝑑 𝑏𝑒𝑐𝑎𝑢𝑠𝑒 𝑜𝑓 ℎ𝑒𝑟 𝑘𝑛𝑖𝑓𝑒. He is the most ruthless. 𝑂𝑛 𝑡ℎ𝑒 𝑠𝑎𝑚𝑒 𝑙𝑒𝑣𝑒𝑙 𝑎𝑠 ℎ𝑒𝑟 She never opens her heart. 𝑆ℎ𝑒 𝑜𝑛𝑙𝑦 𝑑𝑖𝑑 𝑜𝑛𝑐𝑒 _______________________ 𝐓𝐡𝐞𝐲 𝐬𝐚𝐲 𝐟𝐞𝐚𝐫 𝐭𝐡𝐞 𝐝𝐞𝐯𝐢𝐥, 𝐛𝐮𝐭 𝐰𝐡𝐚𝐭 𝐚𝐛𝐨𝐮𝐭 𝐭𝐰𝐨 𝐡𝐢𝐝𝐝𝐞𝐧 𝐮𝐧𝐝𝐞𝐫 𝐭𝐡𝐞 𝐬𝐚𝐦𝐞 𝐬𝐡𝐚𝐝𝐨𝐰? 18+, read trigger warnings.
Family is strength ✔ by unknown_wings
29 parts Complete Mature
//Highest ranking: #1 in over protective// Lilith is a 14 years old girl. she is the opposite of her name. she is sweet, innocent and naive. she loves everyone just like an Angel. she lives with her abusive mother, who abuses her because her face resembles her so much. His husband leave her after Lilith birth and she started to abuse her while thinking he leave because of Lilith. Lilith gets beaten up every day but didn't say a word against her mother but what happens when her mother throws her out of the house at 1 pm. what will she do? What if some men try to rape her and a man save her? The man is none other than the leader of Blade Mafia. what if she catches the eyes of the cruellest and rude leader. he wants her to be his daughter but what when his own family has some problems. Will things gonna work out? will his family gonna accept Lilith? What if they found out about her past? will they still accept her or gonna leave her like everyone? Will they gonna cope up their problems together and gonna broke each other more? We called family is our strength. Will, they gonna become her family and give her the happy life she deserves? Read to find out........
BLEEDING [✔️] by velvetydays
46 parts Complete Mature
Sep, 26, 2021 : #67 in romance Sep, 26, 2021 : #15 in drama Sep, 12, 2021 : #2 in loving April, 29, 2023 : #1 in mystery-thriller NOT EVERYTHING IS HOW IT SEEMS LIKE ! EVEN THE TOUGHEST OF MEN COULD BE BLEEDING INSIDE This quote perfectly summarises life of Sam "Devil" Williams. He is a tough and strong man. A Merciless Streetfighter and favourite man of Damon Esposito, a well known and highly feared Mob Boss. He beats people until they're on their knees begging for Mercy. But was he like this ever since ? Was he a "devil", parents told stories of to their children. No ! No he wasn't, not until his world was crumbled before his eyes by this Evil World. But what will happen when Chloe Moretz, a cute, kind, slightly shy and bubbly girl stumbles across his path. Things will definitely get TWISTED Watch their journey FROM "She is trying to pull me back to the World that abandoned me because of the crime I never committed and pushed me to the edge where killing myself seemed an alluring option." TO "In The Midst Of All This Chaos It's her love keeping me Sane !!"
Revenge With The Enemy by x-night-travels-x
38 parts Complete
Aurora Lopez had the intentions and goals of starting new, and having a normal life. She was met with difficulties along the way, and one of those difficulties ended up being the reason she wanted to start new in the first place. It was her father. She fought hard, and claimed she didn't want him in her life. And She protected her sister with everything left in her. She does mistakenly think she falls in love, but what she has yet to find out that he ain't the right one for her to fall for. Deep down she knew, but she avoided the truth until one day he had a proposition for her, something she couldn't resist.
criminal masterminds by toxic_girl2002
45 parts Complete
A world where everything is stereotypical. Girls can't work and are treated as slaves. Boys always have the upper hand. A story where a 21 year old girl named Bree has to be trained into being a house-wife. Then forced into a marriage with a boring, disgusting man named Eric But what happens when there is freedom. when one day she bumps into the Mexican mafia and she had a choice. Stay or leave. So she runs away with them. They become her family, her friends, her life. what happens when she opens an illegal club underground and falls for a certain criminal What happens when Eric finds her... What happens when she finds her long lost brother in this club... What happens when secrets are revealed...
My family Code by b00tr0v3rt
34 parts Ongoing
What happens when our 16 year old girl Lilith decides to run away from home? And what happens when exactly who she was running from turns up dead? What if we add the fact she now moves into a completely different city with a new family. While Lilith hides her secrets her brothers hide their own. Who spills first and what will happen when Lilith finds out about her brother's most important secret. Will the family recover? Because some secrets are not meant to be shared.
You may also like
Slide 1 of 10
The Assassin and the Gang✔️ cover
The Only Queen cover
Desire (18+) [Complete] cover
MR AND MRS MAFIA cover
Clandestine | 18+ cover
Family is strength ✔ cover
BLEEDING [✔️] cover
Revenge With The Enemy cover
criminal masterminds cover
My family Code cover

The Assassin and the Gang✔️

44 parts Complete Mature

Lilith is bad bitch, but she is one of the nicest people ever as well. She is sweet, likes to go shopping, loves food, and especially pancakes. And she kills people for a living. "Princess? Bitch, I'm a queen." Steel is a gang leader, and thought everyone was beneath him. He was a cold blooded asshole, but that wouldn't stop him from getting what he wanted. What happens when Lilith goes to same school as Steel? Will she be able to stop herself from kicking his ass, or will she be the one begging for mercy instead? There is always more at play then what meets the eye. And Steel doesn't always realize that. Lilith has to make allies and friends, to be able to bring the people who took everything from her down. "I wanted her so badly. I just needed to know how to get her. Lilith. It was such a glamorous name. And it sounded so sweet. " ~ ✨THIS IS NOT A CLICHE✨ ALL RIGHTS GO TO ME ISTG IF YOU GUYS STEAL MY IDEA IMMA RIOT- ~

More details