The Slayers Of The Seven (Old Version)
BackgroundAntagonist
  • Reads 1,028
  • Votes 149
  • Parts 24
  • Time 2h 27m
  • Reads 1,028
  • Votes 149
  • Parts 24
  • Time 2h 27m
BackgroundAntagonist
Ongoing, First published May 22, 2022
actionaction-adventureadventurecharacterdevelopmentcharacterscomedycultsdarkdarkfadarkfantasydarkmagicdramaevilfantasyfantasyadventurefantasycreaturesmysterypoliticsromance
This is an older version of The Slayers Of The Seven. A newer version will be posted soon

The Kingdom Of Sela is threatened by the verge of collapsing in on itself. The royal family all poisoned, leaving no heir to the throne. The councilmen quickly put up five candidates that were fit to rule according to the Primordial Scroll. Elwen Flavius is one of those candidates and is probably the least likely to win out of the five but with help from an assassin high elf, undead lizardfolk, potion scientist human, amnesiac half elf and a bard human could possibly shift the political tide for her. 
[Cover by CBMokedi]
[Thank you to RoundWeGo and beetlefiend for helping with looking over the story]
All Rights Reserved
actionaction-adventureadventurecharacterdevelopmentcharacterscomedycultsdarkdarkfadarkfantasydarkmagicdramaevilfantasyfantasyadventurefantasycreaturesmysterypoliticsromance
Table of contents

24 parts

Sign up to add The Slayers Of The Seven (Old Version) to your library and receive updates
or
#530cults
Content Guidelines
You may also like
The Traitor of Inlustris by rose-crowned
77 parts Complete
As a new queen rises to power, the kings of Caeleste grow unrest. The Inlustris in their sights, they send an assassin to Antonella Feulune's palace, and the war is declared. Inexperienced and filled with grief, Antonella sends off her fiancé on a thirty day trip to get her a rose in hopes of feeling better. She takes the opportunity to use her magic to disguise herself as a commoner and escapes palace grounds, her goal to find all the information needed to defeat the surrounding kingdoms of Caeleste before they flattened them into nothing. When she runs into dangerous rogue gang, the Tenebrosus Bleeders, she's forced to join them to avoid having her head severed from her body. Parading around as a gang member, she must keep up with her disguise. Tensions are heightening. The people are turning against her. The land of Caeleste is suffering. But she will not allow the Inlustris to fall into the hands of the greedy, and she's not afraid to burn everything to the ground to protect it. A battle of light and dark magic, buried secrets, manipulation, and betrayal. ********************* Cover: @aneonsky
War Of Men by hopefulgoat
39 parts Complete
(Currently being edited) ~ Book 1 of the Esprian Novels ~ In the kingdom of Cines, legends speak of five spirits that are the guardians of the land. At all times, there is one girl in the kingdom that represents one spirit, the bridge between Lypera and the spirit world. Only the last five were assassinated. Now five new girls have been selected and are introduced to a new world of intrigue and splendor. But as politics spiral towards a war and new secrets come to light, is there any hope for justice? (Originally an applyfic) Contains: toxic relationships, mild violence (rarely), PTSD, mentions of child neglect
Carrion Chorus by bum1881
32 parts Complete Mature
The dark and painful story of an unforgiving, cruel city which seeks to crush all those who live in it.. To those uninitiated, ''Altstadt.'' Standing atop, noblemen from the First War look down upon peasants who are banished from birth to rot in a fetid wasteland. Belial, one of these peasants, is a ''black swan'' among his peers, hiding something dastardly deep within his very self. The second point of view, Belial's direct inverse, Servius Crowfeather. A noble duke from an esteemed family who claws desperately at the murk to take back that which was stolen from him so long ago... The calm still and raging fire of both Belial and Servius' dreams have the power to shift the course of Alstadt's recluse history forevermore... Yet the question remains. Will they?
Darkling by NightTime_Storiexs
51 parts Complete
Clara is restarting life. Unwillingly, when her father decides to move from good old New York City to isolated Ilea. Clara is Ethereal Ilea is a kingdom. And 'Arcane High' is her new school. Except... that school isn't quite for humans. It has some students that are supernatural. Then comes Callum. The mystery no one has been able to solve. The boy with multiple powers yet nothing to go by. Because no one knows what he is. Callum is a Darkling Being drawn to someone or something can be extremely dangerous. Because curiosity killed the cat. But what do they say? Satisfaction brought it back. . . . . . ALL RIGHTS RESERVED DON'T STEAL MY BOOK ISTG I'LL SUE YOU
Soturi Academy: Secret's Lost by JalissaPastorius
41 parts Complete
|COMPLETE| When the river runs red, Death shall bring forth a new entity, and A new age of evil Only one imbued by all Shall prosper with a partner. A wayward prophecy, the driving force behind a shift of power within the realm of Divergona sends old magic tumbling across the land in preparation for war. The gods were at a standstill and only one imbued by all could end the war. There was just one problem, no one knew who the mystery person was. Caelia Ninarth, an orphan with a knack for fighting sets out on a journey of a lifetime to join the empyreal vanguard. It would give her the ability and means to provide a better life for the children at the orphanage while quelling her thirst for battle. She needed to get her hands on a weapon and fast. The last thing she expected was to stumble upon a rusty sword at a merchant's tent. Now all she was missing was a trainer. With her magical sword as a best-friend, she was ready to past the trials and enter Soturi Academy-the legendary school of warriors. But when children start disappearing, Caelia's skills will be put to the test. There's no room for error or it'll cost her her life. Can her new friends, and allies help her succeed or will the gods turn their backs on her and leave her to fail? Read and find out. © 2018 All Rights Reserved Jalissa Pastorius Cover by Creative Paramita Highest Rankings #3 Epicfantasy #16 Youngadultreads #138 Romance
The Battle of Kingdoms and Clans by MaeViola175
26 parts Ongoing Mature
Please note- this is a WIP, You may find some typos. The fae princess of a tyrant king leads her friends into a rebellion that changes the course of history. While she attempts to overthrow her father, she discovers the dark riders, an ancient linage and history that will solve everything. With the assembled rebels against the crown as her army, they fight while uncovering who the destined true ruler really is as said by the ancient prophesy. Mysteries are solved, battles are fought, hearts are broken, love is found and lineage is revealed, leading to a whole new world of potential, including a love triangle, and of course fated mates. Mature for language spice.
The Bane of the Empire by AnnyVirdi
41 parts Complete
The world is ruled by a tyrant King. The Old King was killed and with him the magic that coursed through the world was sealed away. Dawn Rentradie, a human girl, is sent to Eastmaw to collect a tome that triggers a sequence of events that places her in the path of a Fae warrior named Hunter. Follow Dawn, as she uncovers the secrets of a world just out of reach but all around her. Turns out magic wasn't just a children's story. Genre: Young adult, High Fantasy, Adventure, Romance, Fae Folklore
The Reaper's Curse #1 - Complete by Kiahni_C
56 parts Complete
❝ An exile should remember that they will die in these lands and there is nothing they can do but fight. ❞ [complete | editor's pick | book 1] The Reaper's Curse has come, the gods have foreseen death and people are helpless to fight it. Those infected lose their minds, feasting on souls and flesh. Surviving the Reaper's Curse means being forced from Muovea's capital and into exile, abandoned and forgotten. Alicia Zalana had her entire life before her, destined for greatness amongst the opulent palace of the capital. But when the queen is murdered and Alicia is the only one who knows who did it, she's compelled to play her hand and risk exile. Or much, much more. As long-forgotten legends begin to stir beneath the ancient stone of Muovea, Alicia will discover just how much she's willing to sacrifice, and just how much she cares for the captain who saved her life. ➳ Wattpad Editor's Pick (May 2020) ➳ Featured in @WattpadDarkFantasy's 'The Bestiary' reading list ➳ Featured in @Fantasy's 'Dark Fantasy' reading list ➳ Featured in @StoriesUndiscovered's 'Diamond' reading list ➳ Featured in @WattpadZombies' 'Voodoo Hoodoo' reading list ➳ Featured in @SpeculativeFiction's 'More Than The Eye Can See' reading list ➳ Complete! ➳ This book is part of a duology (a two book series) and is the first. The second and final book is 'The Grey Blood'. ➳ Recommended 15+ for depictions of violence and some coarse language. ➳ Previously titled 'The Black Taint'. ➳ Cover created by the wonderful and talented @soundthealarm [[word count: 100,000 - 150,000]]
You may also like
Slide 1 of 8
The Traitor of Inlustris cover
War Of Men cover
Carrion Chorus cover
Darkling cover
Soturi Academy: Secret's Lost cover
The Battle of Kingdoms and Clans cover
The Bane of the Empire cover
The Reaper's Curse #1 - Complete cover

The Traitor of Inlustris

77 parts Complete

As a new queen rises to power, the kings of Caeleste grow unrest. The Inlustris in their sights, they send an assassin to Antonella Feulune's palace, and the war is declared. Inexperienced and filled with grief, Antonella sends off her fiancé on a thirty day trip to get her a rose in hopes of feeling better. She takes the opportunity to use her magic to disguise herself as a commoner and escapes palace grounds, her goal to find all the information needed to defeat the surrounding kingdoms of Caeleste before they flattened them into nothing. When she runs into dangerous rogue gang, the Tenebrosus Bleeders, she's forced to join them to avoid having her head severed from her body. Parading around as a gang member, she must keep up with her disguise. Tensions are heightening. The people are turning against her. The land of Caeleste is suffering. But she will not allow the Inlustris to fall into the hands of the greedy, and she's not afraid to burn everything to the ground to protect it. A battle of light and dark magic, buried secrets, manipulation, and betrayal. ********************* Cover: @aneonsky

More details