His and Her's
Iamseriyah1
  • Reads 39,789
  • Votes 225
  • Parts 2
  • Time <5 mins
  • Reads 39,789
  • Votes 225
  • Parts 2
  • Time <5 mins
Iamseriyah1
Ongoing, First published Jul 06, 2022
Mature
bestfriendsbetrayalchallengecheckmatefriendshipgoodgirlgrowthjamaicalovematureaudienceromance
Journey's  can be a funny thing you see, you'd think that because you know exactly where you want to go and what you want to do, your journey would be easy, but what will happen when that journey takes a detour? 

What will happen He meets Her and all things take a huge turn? 

What will be the result when two different paths collide?, will it sparks a deadly fire or will it spark undying love?
Public Domain
bestfriendsbetrayalchallengecheckmatefriendshipgoodgirlgrowthjamaicalovematureaudienceromance
Table of contents

2 parts

Sign up to add His and Her's to your library and receive updates
or
Content Guidelines
You may also like
Pretty Likkle Sinna (Under Editing) by 1Ari_don
33 parts Complete Mature
You feel mi a gold digger i said lookin at him with disgust. Mek mi tell you dis mi noh frighten fi your money cause mi have mi own money and mi parents dem money Fi spend suh mi noh know weh you come yah bout.
Unexpected by BlueViolet_X
71 parts Complete
One single meeting on the plane ride home turns out to be the beginning of something new. The short journey brings together two people who aren't even looking for love and may not have even given each other a second glance if the circumstances didn't demand it. But what happens when the mysterious boy shows up at her school a few months later? Will it lead to the kind of love that everyone desires or is it doomed from the beginning? Sometimes, the most unexpected thing can turn out to be the most beautiful. But that doesn't mean it won't lead to pain and heartache.
Once again...Life goes on by RimIbrahim1
16 parts Complete
Sometime love brings you happiness, But, What if your Love story is like Amy's Will you be happy? Will your love remain for a person who left you for no known reason? What about Noah, Who is he, and how did he get to be in Amy's life ? why did he betrayed her? After all those crazy years... will they meet again? Once again life goes on.... #Completed
𝑭𝒓𝒂𝒊𝒍 𝑳𝒐𝒗𝒆 by unrkived
33 parts Ongoing Mature
"𝑾𝒐𝒖𝒍𝒅 𝒊𝒕 𝒉𝒂𝒗𝒆 𝒘𝒐𝒓𝒌𝒆𝒅 𝒐𝒖𝒕 𝒃𝒆𝒕𝒘𝒆𝒆𝒏 𝒖𝒔 𝒊𝒇 𝒕𝒉𝒆𝒓𝒆 𝒘𝒂𝒔𝒏'𝒕 𝒔𝒐𝒎𝒆𝒐𝒏𝒆 𝒆𝒍𝒔𝒆?" "𝑰𝒕'𝒔 𝒏𝒐𝒕 𝒚𝒐𝒖𝒓 𝒇𝒂𝒖𝒍𝒕 𝒕𝒉𝒂𝒕 𝒚𝒐𝒖 𝒅𝒐𝒏'𝒕 𝒍𝒐𝒗𝒆 𝒎𝒆" ᴄʜᴏᴏꜱᴇ ᴍᴇ! ʟᴏᴠᴇ ᴍᴇ!...ᴡʜʏ ᴄᴀɴ'ᴛ ʏᴏᴜ ᴊᴜꜱᴛ ʟᴏᴠᴇ ᴏɴʟʏ ᴍᴇ?
Fatal Flaws by JohnNAshley
47 parts Ongoing Mature
****MATURE LANGUAGE AND SEXUAL CONTENT***** Book 1 in the Fatal Series Fairy tales are amazing. They are sweet and romantic, something everyone wishes were real. They're a tale as old as time. A good girl meets a troubled boy. She helps him change his ways, and they live happily ever after. But what happens when that's not the case? What happens when two damaged souls find their way to each other? Does only one of them have to change for their love to work? Can either one of them truly ever get passed the other person's past? Or will all the lies, secrets, and betrayals be just too much for them to handle? College was never even an option, but now it's a reality. This is a new beginning. A chance to move on and break old habits. Until it's not. Once Bex meets a certain bad boy with a rep everything she has been working on is out the door. She soon learns some habits are harder to break than others. Is this new boy exactly what she needs in her life or is he the worst thing to happen to her? happen to her? Can two trouble souls save each other or will they both drown?
Title - RouTEEN Love Story by Sharadmalhotra009
15 parts Complete Mature
This Routeen Love Story Is Described above a wonderful Lovers even this 2 people's to don't know what will happens in there life actually in every one like boy's life or girl's life changes in only one situation that is when the 2 people started loving each other even if they 2 are before first they are friends means also they fall in love because love is a type of magic type if we are in love in boy or girl then definitely we will won't sleep night even and our all thoughts is only about our love person only and then we will think about ourselves not only our loved member we will think more and our loved person thinks about ourselves, cares about us and on that time we can't explain the feeling how we are feeling on that time but we will won't express on them our feelings towards them but they always know what we are feeling on them 1. Gender : Romance/Romantic Love Story 2. Language : English 3.Tags : Love-triangle,Twisted, Dare to Love & Hate, friend to lovers, Mystery, First Love, childhood crush, possessive, Love At First Sight Story Rating : 18+ Period : {CONTEMPORARY , ALTERNATIVE - TIMELINE , HISTORICAL , FUTURE. }
Adeline by Bubblessss_2
45 parts Complete Mature
"𝐈 𝐧𝐞𝐞𝐝 𝐲𝐨𝐮 𝐥𝐢𝐤𝐞 𝐭𝐡𝐞 𝐚𝐢𝐫 𝐈 𝐛𝐫𝐞𝐚𝐭𝐡, 𝐀𝐝𝐝𝐲" 𝐓𝐡𝐞 𝐟𝐢𝐫𝐬𝐭 𝐛𝐨𝐨𝐤 𝐢𝐧 𝐭𝐡𝐞 '𝐄𝐯𝐞𝐫𝐠𝐥𝐚𝐝𝐞 𝐌𝐚𝐧𝐨𝐫' 𝐬𝐞𝐫𝐢𝐞𝐬 𝐀𝐝𝐞𝐥𝐢𝐧𝐞 𝐖𝐡𝐢𝐭𝐦𝐨𝐫𝐞 seems to have bad luck follow every one of her steps. However she can't help but feel excited when her and her siblings are offered a scholarship to most prestigious school in her town. With her Mom constantly struggling to keep her family running due to the lack of income her family receives. Adeline is forced to pull her weight for her family by working more than 2 times a week, causing pure exhaustion and anxiety. When time rolls around and suddenly Adeline is buttoning up her uniform for school, she's shocked as to why 𝐃𝐚𝐦𝐨𝐧 𝐁𝐚𝐥𝐚𝐧𝐜𝐡𝐢 calls out to her in the hallway. 𝐃𝐚𝐦𝐨𝐦 𝐁𝐚𝐥𝐚𝐧𝐜𝐡𝐢 a boy who's past is constantly haunting him and coming back to bite him in the ass. Can't help but be drawn to the new girl. He doesn't know her name, he doesn't know where she comes from. He doesn't know anything. However the only thing he does know, is that he can't help but feel pulled towards her. He knows he's done for when he can't help but answer the question for her in math class... A story full of ups and downs. Where will this story lead us? 𝐋𝐞𝐭𝐬 𝐟𝐢𝐧𝐝 𝐨𝐮𝐭... 𝐓𝐨𝐠𝐞𝐭𝐡𝐞𝐫
These Broken Pieces by storiesinsideme
27 parts Complete
What happens when two broken hearts collide? [EDITING] TW// contains sensitive content about self harm, depression and suicide
forbidden love by Itzlyss06
9 parts Complete Mature
it starts like no other, two long lost souls reconnecting though past events will this change their feelings for each other? will times change? Or will their families get in the way? Will they make their own family? Find out more...
His. by itsyogirlkay12
42 parts Complete
(THIS IS A FAST BURN BOOK‼️‼️) all of lilah's life shes been in shitty relationships until she meets damian whose a christian boy that gives her princess treatment but will it last like that while she falls for a upcoming Don
You may also like
Slide 1 of 10
Pretty Likkle Sinna (Under Editing) cover
Unexpected cover
Once again...Life goes on cover
𝑭𝒓𝒂𝒊𝒍 𝑳𝒐𝒗𝒆 cover
Fatal Flaws cover
Title - RouTEEN Love Story cover
Adeline cover
These Broken Pieces cover
forbidden love cover
His. cover

Pretty Likkle Sinna (Under Editing)

33 parts Complete Mature

You feel mi a gold digger i said lookin at him with disgust. Mek mi tell you dis mi noh frighten fi your money cause mi have mi own money and mi parents dem money Fi spend suh mi noh know weh you come yah bout.

More details