The Assassin Gamer
Heavenium
  • Reads 1,448
  • Votes 90
  • Parts 39
  • Time 3h 44m
  • Reads 1,448
  • Votes 90
  • Parts 39
  • Time 3h 44m
Heavenium
Ongoing, First published Aug 03, 2022
actionassassindarkfantasyfantasygaminggraphiccontentharemhentaimagicmanipulationmythologyrevengeromancesexscenestragic
Noctis Hashima is a former high-earning marketer who gets sucked into a game dimension after his brother's death. His father called on him to be his brother's replacement and avenge his brother's death.  He also get's romantically involved with female players in the game. 
Will he be able to use his skills as a pro gamer to beat the game, or will he repeat the same mistakes his brother did?
All Rights Reserved
actionassassindarkfantasyfantasygaminggraphiccontentharemhentaimagicmanipulationmythologyrevengeromancesexscenestragic
Table of contents

39 parts

Sign up to add The Assassin Gamer to your library and receive updates
or
#604graphiccontent
Content Guidelines
You may also like
Bastard of Lust (Moved) by defaultlemon
25 parts Ongoing Mature
//READ END CHAPTER// //This Book will be reposted and re-edited on 'Archiveofourown.org' for free and will continue receiving updates there :)// A total loner of a man dies in a classic predicament and is reincarnated by the God of Lust and Fertility in a world between worlds where every figment of human imagination becomes reality, his goal? Live his dreams as best he can as a young boy named Nim and have sex with as many lewd sexy beings as he can to impregnate them all! Note: For fellow down bad degenerates and men/women of culture, This is wish fulfilment and has unrealistic sex properties with strange and gross fetishes as well as a good amount of incest, rape, etc. so if not for you simply don't read.
Ready, Set. by promisezz
35 parts Complete Mature
Kenma transfers to Nekoma for his second year, while interested in joining the volleyball team, he's wary of his own abilities and the dynamic of the team already. Kuroo fixates on the new second year, convincing him that joining the team is the right thing to do. The two of them spiral into an intense relationship, somethings are built to last and others fall apart. Kuroken fanfiction Smut/Mature (chapters marked with * are more graphic ) Most names are from the show, some are not. Years are not matched to the show.
𝑻𝒉𝒆 𝑮𝒐𝒅 𝑯𝒂𝒔𝒉𝒊𝒓𝒂 | 𝙺𝙽𝚈 𝚡 𝙼𝚊𝚕𝚎!𝙾𝚌 by casey_kc25
93 parts Complete Mature
His 𝚜𝚙𝚊𝚛𝚔𝚕𝚒𝚗𝚐 grey 𝚎𝚢𝚎𝚜 𝚜𝚑𝚘𝚗𝚎 𝚝𝚑𝚛𝚘𝚞𝚐𝚑𝚘𝚞𝚝 𝚝𝚑𝚎 𝚌𝚘𝚞𝚛𝚝𝚢𝚊𝚛𝚍, 𝚊 𝚑𝚒𝚗𝚝 𝚘𝚏 𝚖𝚊𝚕𝚒𝚌𝚎 𝚒𝚗 𝚝𝚑𝚎𝚖, "𝐈 𝐡𝐨𝐩𝐞 𝐢𝐦 𝐧𝐨𝐭 𝐥𝐚𝐭𝐞..." ** Tatsuo Miyake, the fated God Hashira. He's strong, protective, and handsome. What lady wouldn't want him? Oh, that's right. The lady who didn't want him, was his mother... a goddess... (I do not own Kimetsu No Yaiba or any of its characters, I only own my character and the scenes associated with him, mild harem: character depiction for my OC is Yoo Joonghyuk from Omniscient Reader's Viewpoint) (Includes sensitive topics)(Rengoku x Uzui x Male!Oc)(does include smut- you've been warned, you can skip the smut chapters so you don't have to read them)
Game of Insomnia | ✓ by pillowsonfire
37 parts Complete
[BOOK ONE] A Final Fantasy XV, VII and XIII Crossover °°°Noctis' childhood friend, the Healer, had died after she battled with a daemon that attacked them eleven years ago. Hoping that his friend is still alive, Noctis re-opened the Game of Insomnia to find her secretly. Despite of being careful with the search for the Healer, there still existed people who plotted to poison King Regis, dispatch Noctis and take over the throne of Lucis.°°° STARTED | 10-08-16 ENDED | 04-04-18
Crown King: Return of The Labyrinth | ✓ by pillowsonfire
33 parts Complete
[SEQUEL TO GAME OF INSOMNIA] °°°The world of Eos has finally lived in peace for years after the war ended and the domain of Niflheim itself no longer existed. By the time he turns 25, Noctis gets crowned as King. No more threats, chaos and quarrels among civilians and with (Y/N) by his side, he was sure the peace in their lands would last till the end. Or. . . was it just what they thought? Moreover, a plague called Starscourge, starts to spread throughout Eos. And 'someone' from the past was not what they wanted to hear about.°°° STARTED | 04-28-18 ENDED | 06 - 14 - 20 June 14, 2020: #7 in Cloud
𝐄𝐥𝐞𝐜𝐭𝐫𝐨 𝐆𝐨𝐝𝐝𝐞𝐬𝐬 [Kny x Raiden Ei!reader] by ReepaChanuTakhelamba
7 parts Ongoing Mature
Raiden Y/n and her older twin sister Raiden Makoto live a happy family with their parents at the village but in the night y/n's parents got murders by the demon. The Ubuyashiki raised the both Y/n and makoto when they were 11 years old. Makoto was become the electro hashira at 14 year old and Y/n was still at her training. Makoto was killed by the upper moon two, Douma. The one who killed the flower hashira, Kanae Kocho and Makoto was death just like Kanae at the mission. Y/n heard that news, she become sad because she lose her family. Y/n trained harder and she become a demon slayer at one years and Oyakata-sama let her to became a new electro hashira. [SLOW UPDATE!!] • ────── ✾ ────── • ❑ Kny x reader ❑ Kny x Raiden Ei! reader ❑ Raiden Ei! reader ❑ Various x reader • ────── ✾ ────── • Kimetsu no yaiba and Genshin impact doesn't belong to me. • ────── ✾ ────── • !Warning! Blood Swearing Fluffs Yandere
Diamond Heart, Crystal Eyes [FF15 Modern Au] love story by Idolgirl30
32 parts Ongoing
Noctis and Kina are childhood friends until Noctis leaves Kina without a single word to her. Now years later Noctis comes back into her life as her entire life crashes down around her. Will he be able to save her from the things that have made her become so distant from him or will it only make her be away from him even more?
Noctis Lucis Caelum x Reader OC | Memories | by Neko-Chan94
25 parts Complete
Noctis Lucis Caelum Fanfiction!! |English is not my first language, therefore I apologize in advance for spelling errors / grammar and any other mistakes, please bear with it. I am not a perfect human being- Thank you. Also if a phrase does not match your appearance, please just imagine it the way that it fits your image.|
Gaming Badly In DxD (HighSchool DxD) by HamsterX42
21 parts Ongoing Mature
A soul floats in the middle of nowhere. Is there no customer service in the void? How rude. A random weeb is granted the chance to live a new life with a slightly different Gamer System. There is no bad gaming. Only gaming badly, right?
Noctis x Reader ~After Midnight by FFXVsummoner
24 parts Complete Mature
A young maid learning of the past decisions of her father. A prince discovering the true sacrifices he must make as future sovereign of Lucis. Noctis Lucis Caelum has returned from his journey alongside his entourage, reclaiming Insomnia under their rightful owners. Reclaiming the throne was only one of the steps of becoming king. The next was growing accustomed to the laws upheld in the palace. And being assigned a maid in order to fully accentuate his stay. Yet, the past of her own father was creeping closer in the shadows, disrupting the cherished relationship Noctis has developed with her... Crossover between Final Fantasy XV and Final Fantasy XIII universes. Final Fantasy XV parallel events from actual game.
You may also like
Slide 1 of 10
Bastard of Lust (Moved) cover
Ready, Set. cover
𝑻𝒉𝒆 𝑮𝒐𝒅 𝑯𝒂𝒔𝒉𝒊𝒓𝒂 | 𝙺𝙽𝚈 𝚡 𝙼𝚊𝚕𝚎!𝙾𝚌 cover
Game of Insomnia | ✓ cover
Crown King: Return of The Labyrinth | ✓ cover
𝐄𝐥𝐞𝐜𝐭𝐫𝐨 𝐆𝐨𝐝𝐝𝐞𝐬𝐬 [Kny x Raiden Ei!reader] cover
Diamond Heart, Crystal Eyes [FF15 Modern Au] love story cover
Noctis Lucis Caelum x Reader OC | Memories | cover
Gaming Badly In DxD (HighSchool DxD) cover
Noctis x Reader ~After Midnight cover

Bastard of Lust (Moved)

25 parts Ongoing Mature

//READ END CHAPTER// //This Book will be reposted and re-edited on 'Archiveofourown.org' for free and will continue receiving updates there :)// A total loner of a man dies in a classic predicament and is reincarnated by the God of Lust and Fertility in a world between worlds where every figment of human imagination becomes reality, his goal? Live his dreams as best he can as a young boy named Nim and have sex with as many lewd sexy beings as he can to impregnate them all! Note: For fellow down bad degenerates and men/women of culture, This is wish fulfilment and has unrealistic sex properties with strange and gross fetishes as well as a good amount of incest, rape, etc. so if not for you simply don't read.

More details