Autumn Winds - Truth Uncovered | •𝙃𝙚𝙞𝙯𝙤𝙪 𝙓 𝙆𝙖𝙯𝙪𝙝𝙖•
NatsukiKamiyama
  • Reads 32,471
  • Votes 771
  • Parts 29
  • Time 2h 19m
  • Reads 32,471
  • Votes 771
  • Parts 29
  • Time 2h 19m
NatsukiKamiyama
Complete, First published Aug 13, 2022
actionadventurealternateuniverseangstangstwithhappyendingblcomedydetectivedramafanfictionflirtinggaygenshingenshinimpactheikazuheizouheizuhakazuhakazuhaxheizoukazuheiromancesamuraishipteenteenromance
-------------

On his way to the Land of Contracts, Kazuha stumbles upon a familiar and witted detective, Shikanoin Heizou. The detective asks the wanderer if he would join him on an endeavor to explore a domain, to which he agrees. In this lingering moment, they find themselves in the comfort of eachother's presence.

Perhaps, young love is blossoming between the two.... Under the autumn sky, they learn about eachother more and learn to trust eachother. A guilt carried for years, a tale of tragedy... 

As the wanderer and the detective venture off into the domain, after having rested with eachother's presence... they realize that they're more than acquainces or friends... they have already fallen in love. This tale of romance from early beginnings is told in this story.

Note: This story takes place two years after the traveler entered Sumeru.

Note: Genshin Impact belongs to Hoyoverse, not me.

-------------
All Rights Reserved
actionadventurealternateuniverseangstangstwithhappyendingblcomedydetectivedramafanfictionflirtinggaygenshingenshinimpactheikazuheizouheizuhakazuhakazuhaxheizoukazuheiromancesamuraishipteenteenromance
Table of contents

29 parts

Sign up to add Autumn Winds - Truth Uncovered | •𝙃𝙚𝙞𝙯𝙤𝙪 𝙓 𝙆𝙖𝙯𝙪𝙝𝙖• to your library and receive updates
or
#205detective
Content Guidelines
You may also like
Maple Leaves { Kazuha X Reader } by azteryl_
8 parts Ongoing Mature
Friends from childhood, bound together and bursting with happiness, making memories that time could never erase. Together, through sunny days and stormy weather, they laughed, played, and explored. However, things changed, and her mother's death left a deep tragedy and a gaping wound. Following a number of years, he reappeared with a transformed spirit and a heavy burden of suffering. Emotions clash during their bittersweet reunion because he is no longer her friend Since there will be some mature content (drugs, alcohol, blood, etc.) in this If this disturbs you, please don't read, thank you! I'll be using the pronouns she/her since I've written in them the longest. This fanfiction was written entirely by me. The characters in Genshin are all owned by miHoyo; I do not own
𝐄𝐔𝐏𝐇𝐎𝐑𝐈𝐂 ★彡[xɪᴀᴏ, ᴋᴀᴢᴜʜᴀ, ᴀɴᴅ ʜᴇɪᴢᴏᴜ​]彡★ by wasabikawa
18 parts Ongoing
"𝐖𝐢𝐥𝐥 𝐲𝐨𝐮 𝐩𝐥𝐞𝐚𝐬𝐞 𝐛𝐞𝐜𝐨𝐦𝐞 𝐨𝐮𝐫 𝐦𝐚𝐧𝐚𝐠𝐞𝐫?" 𝙄𝙣 𝙬𝙝𝙞𝙘𝙝 𝙮𝙤𝙪 𝙟𝙤𝙞𝙣 𝙩𝙝𝙚 𝙞𝙙𝙤𝙡 𝙜𝙧𝙤𝙪𝙥 𝟒𝙉𝙀𝙈𝙊 𝙖𝙨 𝙖 𝙢𝙖𝙣𝙖𝙜𝙚𝙧 (𝙞𝙣 𝙩𝙧𝙖𝙞𝙣𝙞𝙣𝙜). 𝙒𝙝𝙖𝙩 𝙨𝙩𝙖𝙧𝙩𝙨 𝙤𝙛𝙛 𝙖𝙨 𝙣𝙤𝙩𝙝𝙞𝙣𝙜 𝙢𝙤𝙧𝙚 𝙩𝙝𝙖𝙣 𝙖𝙣 𝙤𝙗𝙡𝙞𝙜𝙖𝙩𝙞𝙤𝙣 𝙩𝙪𝙧𝙣𝙨 𝙞𝙣𝙩𝙤 𝙨𝙤𝙢𝙚𝙩𝙝𝙞𝙣𝙜 𝙢𝙤𝙧𝙚 𝙖𝙨 𝙮𝙤𝙪 𝙗𝙚𝙜𝙞𝙣 𝙩𝙤 𝙛𝙖𝙡𝙡 𝙞𝙣 𝙡𝙤𝙫𝙚 𝙬𝙞𝙩𝙝 𝙖 𝙘𝙚𝙧𝙩𝙖𝙞𝙣 𝙜𝙧𝙤𝙪𝙥 𝙢𝙚𝙢𝙗𝙚𝙧. Xiao x Reader Kazuha x Reader Heizou x Reader (There will be alternate routes for all three mls) Genshin Impact Fem!Reader
Precious Times / KazuHeiScara / Modern AU by AugustSpade
14 parts Ongoing Mature
Kazuha is a young celebrity, who has been acting for famous movies since he was 8. He acts, models, and sings.. he is a boy every teenager girl desires. Heizou is also a young celebrity, who just made his debut and is receiving tons of support from everyone. However, Scaramouche wasn't so lucky. Ever since birth, he was always sickly and weak. What will spark between the three when they all meet on a game named 'Genshin Impact' and become friends? Or maybe even possibly more?
Until We Meet Again [Kazuha X Male Reader] by Rwanda_
23 parts Complete
"What exactly are you?" "I'm a demon, wait no... That will be an understatement... I'm the Devil of the Flame Underworld." ---------- "Love, huh? I've never been loved..." ---------- "You're a human... I'm a Devil..." "You're a mortal... I'm Immortal... How could that work?" ---------- This story does NOT contains; LEMON/SMUT or NSFW content! A Kazuha X Male Reader Story Genshin Impact belongs to Mihoyo The Gray Garden belongs to Deep-Sea Prisoner. I do not own anything except the story.
【Ｈｅａｒｔ　Ｍｅ】(Kazuha+Heizou+Scara+Reader // Xiao+Aether) by itz_fae
24 parts Complete Mature
POV: you and 3 other boys end up getting into a "secret" relationship, but the problem is, you can't decide who you like the most... Your brother has a problem with relationships, and you try to help him as he finds love again with someone he tried to forget. Contains xiaother and "kazuscaraeizou x y/n(reader)" (modern au) CW: -fluff -smut -swearing -violence -su1c1de -drugs -alcohol -angst -r@pe
A Poem Sealed With a Kiss~ // Kazuha X Reader by G0r0uu
37 parts Complete
(Some chapters are edited some are not) You are a traveller originally from Mondstat, You are a sword user as well as a new member of the crux crew. While on the ship, a specific boy catches your eye. (I DO NOT OWN ANY OF THE THE CHARACTERS OF GENSHIN IMPACT, GENSHIN IMPACT, OR THE GENSHIN IMPACT PLOT!)
𝟕𝟑𝟎 𝐇𝐞𝐚𝐫𝐭𝐛𝐞𝐚𝐭! // s. heizou x psychic fem!reader by rredvvelvetccake
5 parts Ongoing
A highschool junior with psychic powers attends school in-person for the first time in her life. However, a keen boy with a brilliant mind poses a threat to her cover, adamant on discovering her hidden truth. . . . With 730 days left, she'd do anything to prevent the inevitable. ━━━ ⌗﹔psychic fem!reader x s. heizou ⸝⸝ - ❥･ highschool au - ❥･ started 9.21.24 (NOT discontinued) ━━━ ᯓ★ cover art by uouofishtown on X
When The Storm Begins || Heikazu by Atamilana
1 part Complete
"You don't even know how much I'd give to be handcuffed by a handsome detective." Heizou spread his arms in a dramatic gesture. Kazuha seemed taken by surprise, but quickly recovered and a lazy smile came to his lips. "I'm not a detective, but I may have an idea." Huh? "What do you mean?" Heizou swallowed. "If you feel like it, visit me tomorrow. I can show you something, although I don't know if it counts as 'handcuffing'." HUH?! *There ARE scenes 18+, you've been warned. Word count: 20 700 words.
Detective Detective (Shikanoin Heizou x FemReader) by CruxGear
49 parts Complete
[NOTE! This is a reupload due to technical issues with my @Cruxgear06_ account; Book Cover art by: 吉草] A rookie detective such as yourself had an encounter with Inazuma's most well-renowned detective, Shikanoin Heizou. It seems like fate has a couple of twists and turns in store for you and the red-haired detective, as you both embark on a journey to solve multiple mysteries together and get to know each other better. But even if the great detective and you, yourself have solved a lot of cases, there are still some secrets that were left unsolved, waiting for the day when it slowly becomes unraveled by fate itself.
You may also like
Slide 1 of 9
Maple Leaves { Kazuha X Reader } cover
𝐄𝐔𝐏𝐇𝐎𝐑𝐈𝐂 ★彡[xɪᴀᴏ, ᴋᴀᴢᴜʜᴀ, ᴀɴᴅ ʜᴇɪᴢᴏᴜ​]彡★ cover
Precious Times / KazuHeiScara / Modern AU cover
Until We Meet Again [Kazuha X Male Reader] cover
【Ｈｅａｒｔ　Ｍｅ】(Kazuha+Heizou+Scara+Reader // Xiao+Aether) cover
A Poem Sealed With a Kiss~ // Kazuha X Reader cover
𝟕𝟑𝟎 𝐇𝐞𝐚𝐫𝐭𝐛𝐞𝐚𝐭! // s. heizou x psychic fem!reader cover
When The Storm Begins || Heikazu cover
Detective Detective (Shikanoin Heizou x FemReader) cover

Maple Leaves { Kazuha X Reader }

8 parts Ongoing Mature

Friends from childhood, bound together and bursting with happiness, making memories that time could never erase. Together, through sunny days and stormy weather, they laughed, played, and explored. However, things changed, and her mother's death left a deep tragedy and a gaping wound. Following a number of years, he reappeared with a transformed spirit and a heavy burden of suffering. Emotions clash during their bittersweet reunion because he is no longer her friend Since there will be some mature content (drugs, alcohol, blood, etc.) in this If this disturbs you, please don't read, thank you! I'll be using the pronouns she/her since I've written in them the longest. This fanfiction was written entirely by me. The characters in Genshin are all owned by miHoyo; I do not own

More details