Story cover for 𝐓𝐡𝐞 𝐇𝐢𝐝𝐝𝐞𝐧 𝐋𝐞𝐠𝐚𝐜𝐲 by ibsyxo
𝐓𝐡𝐞 𝐇𝐢𝐝𝐝𝐞𝐧 𝐋𝐞𝐠𝐚𝐜𝐲
ibsyxo
  • WpView
    Reads 227
  • WpVote
    Votes 102
  • WpPart
    Parts 9
  • WpHistory
    Time 1h 23m
  • WpView
    Reads 227
  • WpVote
    Votes 102
  • WpPart
    Parts 9
  • WpHistory
    Time 1h 23m
ibsyxo
Ongoing, First published Nov 09, 2022
actionbetrayaldarkpastdramafamilysecretshiddentruthsmafiaromancesecretagentvibesstrongfemaleleadthrillertwistsandturnsuncoverthetruth
Two years after her sister's tragic death, Evelyn is trying to keep her head down and live a quiet life. But the past refuses to let her go. With shadows closing in and trust nowhere to be found, she's forced to confront dangers she never expected. Friends move on, lives change, but for Evelyn, the fight for truth-and survival-is only just beginning.

How far would you go to protect your family when everything you believed was a lie?
All Rights Reserved
actionbetrayaldarkpastdramafamilysecretshiddentruthsmafiaromancesecretagentvibesstrongfemaleleadthrillertwistsandturnsuncoverthetruth
Table of contents

9 parts

Sign up to add 𝐓𝐡𝐞 𝐇𝐢𝐝𝐝𝐞𝐧 𝐋𝐞𝐠𝐚𝐜𝐲 to your library and receive updates
or
#689darkpast
Content Guidelines
You may also like
The Baron's Reclamation by Prizzy03
12 parts Complete Mature
Genre: Dark Romance, Thriller, Mafia Fantasy Short Description: In a world of power struggles, deceit, and hidden loyalties, a mysterious and ruthless man known as the Baron returns to claim his rightful throne from his treacherous uncle who once exiled him. Driven by vengeance and ambition, the Baron's journey intertwines with Leah, a captivating but enigmatic woman who has her own secrets and agenda. As Leah infiltrates the Baron's inner circle, seeking to bring down his growing empire on behalf of her father, she finds herself caught in a dangerous web of desire, power, and betrayal. Their undeniable attraction pulls them into a passionate and tempestuous affair, but as the layers of deceit unravel, both Leah and the Baron must confront the truths about themselves and each other. With enemies closing in, loyalties tested, and the stakes rising, they face a harrowing choice: fight for power or surrender to the undeniable bond that could either save them or lead to their ruin. In the end, love and power collide, and only one can emerge victorious as their destinies reach a dramatic and heart-wrenching conclusion.
Untouchable (MATURE CONTENT) by VictoriaSilvaAuthor
45 parts Complete Mature
A love story with betrayal and everything in between. A mafia daughter grows up hiding in plain sight waiting for the day when she will have to take over the Family. Life will challenge her, and love will betray her, but she will fight for her Family and for a love she never saw coming.
Whispers in the Dark by Westerngirl22
1 part Ongoing
Premise: In the shadowy underworld of the Italian Mafia, two lives collide-one of an innocent woman caught in a dangerous game of power, and the other of a ruthless Mafia heir determined to protect his family at any cost. Their love will either be their salvation or their damnation.
Shadows of Verona by Luna_Ree
32 parts Complete
In the sprawling metropolis of Verona, a city divided between its dazzling facade and a dark underworld, Cecilia Bellucci returns after years of exile. Hidden beneath her captivating exterior is a secret connection to the formidable Salieri mafia family, who had raised her as their own. Drawn by an unexplainable longing to uncover her past, Cecilia embarks on a dangerous journey, walking the tightrope between the ordinary world and the criminal underbelly of Verona. With law enforcement agencies and rival mafia clans vying for control, she becomes a pawn in their dangerous game. But an unexpected alliance form with Lucas Moretti, a seasoned detective determined to expose the truth. Together, they unravel a web of corruption, deceit, and forbidden love, discovering shocking truths about Cecilia's past, her ties to the Salieri family, and the true nature of their reign. As darkness engulfs Verona, Cecilia's resolve strengthens, and she vows to bring down the criminal empire that has haunted her life and those around her. In a thrilling tale of justice, redemption, and self-discovery, Cecilia Bellucci steps into the heart of the storm, ready to confront her demons, unveil the truth, and rewrite the destiny of Verona's underworld.
[Complete]Book one: Crimson Lover [Original Mafia! Love story] by Gothgirl1994
40 parts Complete Mature
Four years after Rose's twenty-first birthday she finally finds out who ended up killing her elders. After having two different talks with the son of the man who killed her father-it's now her choice to figure out whether she wishes to give the same treatment to his own men /or/ forgive everything and move on with her life with a new beginning.
Mafia Queen is nice by tejutiger
9 parts Ongoing
She was a woman who held her country above her own life, a patriot in a world consumed by greed. But those around her worshipped wealth over honor, and in their ruthless pursuit, they broke her-mocked her, betrayed her, and forced her into the darkness they thrived in. What they didn't realize was that they weren't creating a victim; they were awakening a storm. In the shadows, she rose-not as a fallen soul, but as a queen of the underworld, a phantom unseen by the world. "When a woman seeks revenge, even the devil takes notes."
The Edge of Light by chuppauthor
39 parts Complete Mature
In a world built on lies, violence, and power, there's no room for softness-especially not in the hearts of those who rule. Nikolai, a ruthless mafia kingpin hardened by betrayal and tragedy, has never questioned his grip on control. That is until Elena, a woman born into a life of privilege yet haunted by her own darkness, crosses into his domain. Torn between their fierce attraction and the impossibility of love in their deadly world, they find themselves bound by secrets neither is prepared to reveal. But when betrayal strikes, and Elena seizes a fleeting chance at freedom, Nikolai's world threatens to unravel. Obsessed with her every move, he's forced to confront his deepest fear: has his love become a cage? And if so, can either of them truly escape? Danger, desire, and deception collide in this heart-pounding mafia romance, where loyalty means everything-and nothing is what it seems.
La Mujer Mafiosa by shadowed_bythe_dark
45 parts Ongoing Mature
It wasn't a life she wanted or chose. It was a life she was bought into. A debt needed to be paid, and her father paid it, even if it was at her expense. His only daughter, the child he swore he loved no matter what, was shipped off at the age of 7 alongside her brother. Surrounded by nothing but powerful, heartless men, she was shown the same kind of mercy they showed their enemies- None. Raised to be a killer, slowly turned into a monster, a life wasn't one she could have. No one knew she existed; she was his little secret, a weapon he kept in his back pocket whenever his enemies got the best of him. Born and raised to be coldblooded, what happens when things between her boss and his enemies put her in the line of fire- playing a dangerous game of trust, love, and hate- and he makes an enemy out of her?
You may also like
Slide 1 of 8
The Baron's Reclamation cover
Untouchable (MATURE CONTENT) cover
Whispers in the Dark cover
Shadows of Verona cover
[Complete]Book one: Crimson Lover [Original Mafia! Love story] cover
Mafia Queen is nice cover
The Edge of Light cover
La Mujer Mafiosa cover

The Baron's Reclamation

12 parts Complete Mature

Genre: Dark Romance, Thriller, Mafia Fantasy Short Description: In a world of power struggles, deceit, and hidden loyalties, a mysterious and ruthless man known as the Baron returns to claim his rightful throne from his treacherous uncle who once exiled him. Driven by vengeance and ambition, the Baron's journey intertwines with Leah, a captivating but enigmatic woman who has her own secrets and agenda. As Leah infiltrates the Baron's inner circle, seeking to bring down his growing empire on behalf of her father, she finds herself caught in a dangerous web of desire, power, and betrayal. Their undeniable attraction pulls them into a passionate and tempestuous affair, but as the layers of deceit unravel, both Leah and the Baron must confront the truths about themselves and each other. With enemies closing in, loyalties tested, and the stakes rising, they face a harrowing choice: fight for power or surrender to the undeniable bond that could either save them or lead to their ruin. In the end, love and power collide, and only one can emerge victorious as their destinies reach a dramatic and heart-wrenching conclusion.

More details