غلاف قصة THE RAPE بقلم MercyAdeniyi
THE RAPE
MercyAdeniyi
  • WpView
    مقروء 13
  • WpVote
    صوت 0
  • WpPart
    فصول 2
  • WpHistory
    الوقت 9m
  • WpView
    مقروء 13
  • WpVote
    صوت 0
  • WpPart
    فصول 2
  • WpHistory
    الوقت 9m
MercyAdeniyi
مستمرّة، تم نشرها في ديسـ ٠٣, ٢٠٢٢
badboycourtdeathevilfamilyfeminismgirlpowergirlsjudgejusticelecturemuslimmysterymystery-thrillerrevengeschoolthrillervengeancewomen
The Rape is a fictional portrayal of Emerald, representing so many females out there who have been caught in the wind of the crass world. This book gives womanhood a voice and makes all of mankind see that being a feminist could be for all. We can all speak up and fight the urge to be an animal. 
The instincts would forever be there as some believe we revolve from mammals, but with each of our bits of help, we can remember that our actions will be held accountable. Remember that girl; She's SOMEONE's Friend, woman, Sister, Mother, Wife.
جميع الحقوق محفوظة
badboycourtdeathevilfamilyfeminismgirlpowergirlsjudgejusticelecturemuslimmysterymystery-thrillerrevengeschoolthrillervengeancewomen
الفهرس

فصلان (2)

قم بالتسجيل كي تُضيف THE RAPE إلى مكتبتك وتتلقى التحديثات
أو
#150judge
إرشادات المحتوى
قد تعجبك أيضاً
Stuck | 18+ بقلم whyyoucarebitch
66 أجزاء مكتمِلة للبالغين
Warning: DARK ROMANCE Story contains detailed mature scenes possessing dubious consent not recommended for age group below 18 years old. YOU HAVE BEEN WARNED! Prologue Shadows engulfed his angelic features oozing devilish intentions. It wasn't until he took a step towards her did the gravity of situation descended upon and even then she couldn't do anything but shake in fear. She knew making a run for it won't do a thing, calling was not an option and if she screamed...she opened her mouth to shrill but a meek plea came out. Her body's lack of response terrified her, tears gathered in her orbs with horrible anticipation. With his each step nearer she gripped the frame of her window tighter hoping to keep her balance. It took him three steps to be inches away from her body. He slowly took his suit jacket off, making himself comfortable as he amusingly watched her shaken face. She was so horror-stricken to even look at his face. She gulped as his hand cupped her neck in a gentle grip, guiding her eyes to his. His eyes slipped from the hold of her eyes to her lips in a second. She grew self conscious all over again. His heated gaze on her lips was unwavering. In the moment of bewilderment and growing self awareness her tongue unconsciously wiped her lips wet and it was all it took for him to descent on her lips. Description Had it been upto him he'd have broken her down to pieces and never put her togather, instead, he let her build herself, he watched her collapse and stand, die and live, float and drown all the while playing her body like a putty in his hand. Her husband had never been gentle, his ways was one of his kind. He read her like a book and used her spells against her. She was vividly aware of what she was getting herself into but nothing could prepare her for the don who brought everyone on his feet and she was no exception. How would she survive his ways or even would she?
Dickhead Syndrome بقلم imfullofpain
30 أجزاء مكتمِلة للبالغين
The story of bullying and romance and gangs. And abuse. It shows how any life can get out of hand. "My boyfriends father is choking me! Because I won't let him rape me!" Does she give in or not? "My family will be looking for you and me. They will come save me so you better let me go." "Your family isn't your family no more we hear that you have gone different paths is that not true. And before you lie. We have a lie detector here. And if anyone goes looking for you they will see your note that you will be gone for awhile." My fear started to eat at me. The overthrowing urge of vomiting came across my body. Does she get out or is she gone forever.
The Dark Side of Living in Florida بقلم janja007
32 أجزاء مكتمِلة
When Emma moved to Florida to get to her dream college, she was, at first, thinking that the town in America would be safe, however, soon, she would be in various situations, from some of her new friends attempting to poison her one night at the bar, to her ex boyfriend that she met on Tinder kidnapping her and even other incidents that happened. Emma was shocked to learn she was not safe in Florida. Will she escape from the dangers of Florida, or end up accepting fate? Chapters: 40 TW (Trigger Warning): There is gore, death, murder, rape and kidnapping involved as well as women being objects in this book, ect. If you have trauma to some of these, please do not read. Read with caution. I am not responsible for triggering your PTSD or getting you involved with therapy.
Cross. بقلم ellaleemargret
فصل 1 مستمرّة
This is a fictional thriller, based on a mother, Ari, returning from Ireland to the UK with her toddler and the child abduction case afterwards. It explores the trapped marriages of the world, where systems, families, social opinion, and the consequences they put on the victim for leaving. It explains how the court systems can be used to try to control and punish someone, but in turn, how they can protect. The complications of courts between two countries' systems. The systems that help, refuge, counselling, and support. Ari has to fight her way through two court systems without spiralling. It shows the understanding and empathy from strangers, friends, family, and charities towards the main character. The positive relationships in the main characters' lives, how sometimes friends and family don't understand, however kindness and humour help. Also, mothers can be made to feel guilty at many different points for different reasons, even when it's over something that isn't the mothers fault. It also has subjects surrounding children diagnosed very early in life with disabilities, the challenges, and breakthroughs that some with it. Themes of stigma and of sympathy.
THE CEO بقلم RainWriter92
55 أجزاء مكتمِلة للبالغين
Rebecca has spent the last four years trying to save her marriage, but once she finds out what her husband is hiding, can she forgive him or will she seek revenge?
Shivangi: The Endless Nights بقلم Amropali
82 أجزاء مكتمِلة للبالغين
A rich spoiled boy from an affluent political family got attracted to a simple middle class girl. He tried to seduce her in vain. So he abducted her and forced himself on her. To make the situation worse his family pressurized her family to keep her mouth shut. They even murdered all the witnesses. With the help of his corrupted family he was acquitted from the rape charge. But the incident changed the girl's life forever. She got pregnant and became bound to give up the custody of the child to his father. Now after twenty-three years she comes back in his life with new look, attitude and identity to seek revenge. She gets help from other honest people, ruined by the same family, in this mission. No it is not a love story, rather a hate story. It lust, passion, desire from his end but hatred, anger, anguish, battle of justice and revenge on her end. [This is my original story. The pictures are taken from the public domain. Images courtesy: Youtube, Pinterest, Google.]
Green & Grey بقلم leiiii403
65 أجزاء مكتمِلة للبالغين
WARNING! This story was my first (unedited/draft). Grammer, plot, etc is messy so please beware! thank you :))) - He couldn't get enough of the emerald in her gaze. And the one colour she thought she'd be afraid of was a colour her heart was set to beat towards a million times a day. - 𝙇𝙖𝙣𝙙𝙤𝙣 𝘼𝙣𝙜𝙚𝙡𝙤 𝙈𝙖𝙡𝙞𝙠. He is the most feared person in their town. Anyone who crossed his way was met with brutality and cruelty within him. He kills without remorse. But when he locks his grey eyes on a pair of green ones, everything he trained to become had vanished, because of her. 𝙇𝙖𝙮𝙡𝙖 𝙑𝙖𝙡𝙚𝙣𝙩𝙞𝙣𝙖 𝙎𝙪𝙢𝙢𝙚𝙧𝙨. She is known and loved by many, she was as gentle and sweet as a flower. She is the light in the darkness. But when she sets her green eyes upon his grey ones, she can't help but let her light shine through the darkness of him.
قد تعجبك أيضاً