Under The Christmas Tree || VMIN || ✔️
-dianxia
  • Reads 1,931
  • Votes 140
  • Parts 5
  • Time 20m
  • Reads 1,931
  • Votes 140
  • Parts 5
  • Time 20m
-dianxia
Complete, First published Dec 20, 2022
Mature
blboyloveboyxboybromancebtsfanficcatvalentinechinachristmasgaynesshyunlixjiminjinkookkorealoveloveatfirstsightminvmpregrainpayuromancesnowflakesopetaehyungvminyeonbin
𝘝𝘮𝘪𝘯 𝘖𝘯𝘦 𝘚𝘩𝘰𝘵𝘴 

𝘱𝘭𝘦𝘢𝘴𝘦 𝘳𝘦𝘢𝘥, 𝘷𝘰𝘵𝘦 & 𝘤𝘰𝘮𝘮𝘦𝘯𝘵
𝘈𝘶𝘵𝘩𝘰𝘳 𝘓𝘪𝘶 [ 𝘓𝘶𝘪𝘴 ] 𝘩𝘦𝘳𝘦. 


𝘴𝘵𝘢𝘳𝘵𝘦𝘥 : 20/12/2022
𝘦𝘯𝘥𝘪𝘯𝘨 : ?/12/2022

𝘵𝘢𝘨𝘴 

#𝘝𝘮𝘪𝘯
#𝘫𝘪𝘯𝘬𝘰𝘰𝘬 
#𝘩𝘺𝘶𝘯𝘭𝘪𝘹 
#𝘺𝘦𝘰𝘯𝘣𝘪𝘯 
#𝘴𝘰𝘱𝘦 
#𝘱𝘢𝘺𝘶𝘳𝘢𝘪𝘯 

𝘲𝘶𝘰𝘵𝘦 𝘪𝘯 𝘵𝘩𝘦 𝘣𝘰𝘰𝘬𝘴 𝘤𝘰𝘷𝘦𝘳 

[ 𝘐 𝘧𝘰𝘶𝘯𝘥 𝘺𝘰𝘶 𝘶𝘯𝘥𝘦𝘳 𝘵𝘩𝘦 𝘊𝘩𝘳𝘪𝘴𝘵𝘮𝘢𝘴 𝘵𝘳𝘦𝘦..𝘣𝘶𝘵 𝘥𝘪𝘥𝘯'𝘵 𝘬𝘯𝘦𝘸 𝘵𝘩𝘢𝘵 𝘺𝘰𝘶'𝘭𝘭 𝘣𝘦 𝘮𝘺 𝘊𝘩𝘳𝘪𝘴𝘵𝘮𝘢𝘴 𝘨𝘪𝘧𝘵 𝘧𝘰𝘳𝘦𝘷𝘦𝘳 ]

𝘱𝘭𝘦𝘢𝘴𝘦 𝘴𝘶𝘱𝘱𝘰𝘳𝘵 𝘮𝘺 𝘣𝘰𝘰𝘬𝘴𝘸𝘦𝘦𝘵𝘪𝘦𝘴 𝘭𝘰𝘷𝘦 𝘺𝘰𝘶 𝘢𝘭𝘭 ♡
Public Domain
blboyloveboyxboybromancebtsfanficcatvalentinechinachristmasgaynesshyunlixjiminjinkookkorealoveloveatfirstsightminvmpregrainpayuromancesnowflakesopetaehyungvminyeonbin
Table of contents

5 parts

Sign up to add Under The Christmas Tree || VMIN || ✔️ to your library and receive updates
or
Content Guidelines
You may also like
For you my love by YouMe9471
9 parts Ongoing
Jimin was a poor boy with no one to love until taehyung enters into his life.... #vmin #yoonkook #BTS #v #taehyung #jimin #baby
Bad Alpha? || Vmin ff by purple_pranpriya
6 parts Ongoing Mature
《Now it's time to have his life back, the life Jungkook stole from him.》 Where Kim Taehyung is left heartbroken after his omega partner for years left him for another alpha, leaving his ex husband in a muse of darkness. To distract himself, he decided to work as a doctor, not knowing that the little too perfect nurse was going to be his biggest distraction, maybe something more too. Will he ever get back his happy life which Jungkook stole from him? Will he ever be able to move on? Ships- Main Ship- Vmin Side ships- Taekook Yoonseok Jinkook Namson © Do not copy!!
♡JIKOOK ONESHOTS♡💋[ RE-EDITING] by Gayy4maQueen
25 parts Complete Mature
Top: Jungkook Bottom : Jimin
Accidental Marriage by hayaat_17
70 parts Ongoing
The story of Abeer Singh Rathore and Chandni Sharma continue.............. when Destiny bond two strangers in holy bond accidentally ❣️ Cover credit : @stoneheart1102 Thank you so much for this beautiful cover. Slow updates Abeer Singh Rathore the hottest billionaire and no.one business man at the age of twenty five years with a strong aura that can make anyone shiver.he is most handsome bachelor of the town. he Arrogant, ruthless, dominating, and a short tempered man with extremely handsome face. love his family and friends a lot and can do anything for them . girls drools over him but he think every girl is gold digger. Chandni Sharma a 20 year's naive girl with beautiful heart.she lost her only family at the age of 18 her grandmother and become a orphan.she is shy and introvert type of girl. Finding you is the biggest surprise and best gift i have ever gotten ❣️ will he accept her as his wife? will he give their marriage a chance? will Chandni make his heart beat for her ? will he became her only family? Copyright ©️ 2024
24 Years by aseboiblue
33 parts Complete Mature
Sequel to School Yard love. No description for this book. I'll spoil it if I put a description. Suggested: Read School Yard Love first From: September 15, 2017 To: November 7, 2018 Text Copyright © AndrewLynn™ 2017-2018 Plagiarism is a crime
D.O.A. (Sequel to D.E.A.) by chicagogirl24
11 parts Ongoing Mature
Jk wanted out of the business to be with Jin, but Charles wants something in return and its something Jk isnt willing to give up so easily. Namjoon and Hobi haven't been heard from in Weeks, its up to the rest of the group to try and find out what happened to them.
Forced to be a queen(Jiminxbts) by Div7bts_lover
13 parts Complete Mature
Jimin is forced to be a queen by painful measures. Warnings; Smut Rape Forced marriage Major character death Abuse Beheading Sad ending Cover not mine but I edited it. Do no plagiarize my book.I do not tolerate that bullshit,and stealing is really bad,I put my all in all my books and so it will not be fair that someone stole it and claimed it as thiers.So think twice before plagiarizing someone's work.
Neighbors by myjinniekookie
21 parts Ongoing Mature
Jin and Jungkook are neighbors from childhood. they were best friends until jungkook choose to be an idol. jungkook left his house at the age of seventeen for his dreams.he got busy with his life and almost forgot about his best friend. jin choose to led a simple life. he often miss his best friend so much. but he can't do anything as he don't want to disturb jungkook.
Purple Trees by minjoonsstars
23 parts Complete
V finds himself deep in love with a regular customer at the coffee shop named Jimin. Jimin is a celebrity in the k-pop industry. Tae is just a regular coffee shop worker. He tries to ignore the fact, that he is in love with jimin but it doesnt work. When the others find out, they force him to ask him out on a date, they end up falling in love for eachother. Based on My gc's help with the idea of vmin.
You may also like
Slide 1 of 9
For you my love cover
Bad Alpha? || Vmin ff cover
♡JIKOOK ONESHOTS♡💋[ RE-EDITING] cover
Accidental Marriage cover
24 Years cover
D.O.A. (Sequel to D.E.A.) cover
Forced to be a queen(Jiminxbts) cover
Neighbors cover
Purple Trees cover

For you my love

9 parts Ongoing

Jimin was a poor boy with no one to love until taehyung enters into his life.... #vmin #yoonkook #BTS #v #taehyung #jimin #baby

More details