malcolm in the middle x addams family
ps2vsxbox
  • Reads 21
  • Votes 0
  • Parts 1
  • Time 51m
  • Reads 21
  • Votes 0
  • Parts 1
  • Time 51m
ps2vsxbox
Ongoing, First published Dec 20, 2022
addamsaddamsfamilydeweywilkersonfamilyfanficfanfictionfestergomezgothicmalcolminthemiddelmalcolmwilkersonmorticiapugsleyressewilkersonwednesday
the brothers of malcolm in the middle live with the addams family for 3 days fanfiction
Public Domain
addamsaddamsfamilydeweywilkersonfamilyfanficfanfictionfestergomezgothicmalcolminthemiddelmalcolmwilkersonmorticiapugsleyressewilkersonwednesday
Table of contents

1 part

Sign up to add malcolm in the middle x addams family to your library and receive updates
or
#14malcolmwilkerson
Content Guidelines
You may also like
this love is good, this love is bad [wenclair] by IsThatUrOverbite13
64 parts Complete
A wenclair fanfiction that takes place right after the end of season 1. Mostly written from Wednesday's POV. Now that Wednesday has a phone, Enid and her won't stop texting. After a tumultuous first week of summer break, Wednesday spends two weeks in San Francisco with Enid. They were planning on spending the rest of the break at Wednesday's. But Enid also had plans with Ajax ... Both girls know that they are more than friends but only Enid is willing to acknowledge it. *kind of a slow burn* Story is mine, most of the setting/characters aren't. (July '23: editing first chapters)
~Thursdays child has vertigo~male Wednesday x reader by CINNAMONbunbun_12
10 parts Ongoing Mature
Male Wednesday X reader Based on the second movie, Addams Family values movie.
Purple Haze by fairytail_4_the_win
39 parts Ongoing Mature
M! Wednesday Addams x F! OC LUCIA KLINE, the daughter of Abigail Craven. A young 17-year-old girl whose purple eyes sparkle in warmth yet kookiness. She holds a dazzling heart-shaped smile that's easy to be infatuated by her. If her soul were a shape it would be of a heart. WEDNESDAY ADDAMS, the eldest son of Morticia and Gomez Addams. A young 17-year-old boy who has dark onyx eyes that hold a deadly yet dull stare. With his piercing stare, it's easy to stay away from him. If his soul were a shape it would be of a skull. Two young souls that instantly clicked upon each other's presence. Such opposites, two souls so different it's bizarre of their connection. The two souls explore these new and strange feelings. However, will fate allow them to be together? Or will loan sharks and murderous nannies get in the way of their forever? FYI this is a fast pace and love at first sight type of book. If you don't like either I recommend not reading if you don't enjoy those types of books. I DON'T OWN ANYTHING OF THE ADDAMS FAMILY! I ONLY OWN MY OCS AND THEIR BACKSTORIES! The Addams Family (1991): COMPLETE Addams Family Values (1993): IN PROGRESS
The Scorned Savior (Harry Potter and the Addams Family) by darkvixen14
12 parts Complete Mature
In the summer of 1994 Harry Potters horrid Muggle family was tired of the constant battle every summer so the sent him away to a summer camp. They did not expect someone as twisted and sadistic as Harry to appear. 14-year-old Wednesday Addams was just like Harry just as twisted and sadistic. From the moment Harry saw her drinking a bottle of poison, and Wednesday saw him down a cyanide capsule the two knew they would be best friends and maybe even more. Trigger Warning: Mentions of Blood, Poison, Burning, torcher and Death just violence in general. Dark!Sadist!Harry Dark!Sadist!Hermione Harry potter and the Addams Family Book one Inspired by Arcadia_Lawliet25
Wenclair one shots ❤️ by AAndrophobia
108 parts Ongoing Mature
Wenclair oneshot stories|| leave suggestions Status- semi/full hiatus until Wednesday season 2 1k hashtags #2 Addamsfamily 10/2/23 #4 wenclair 10/2/23 #4 goth 10/4/23 #1 recommend 12/22/23 #1 preppy 01/6/24 #6 Addamsfamily 03/1/24 #12 gomez 06/24/24 #3 jennaortega 8/17/24 #3 kinks 10/16/24 #1 WednesdayAddams 11/11/24
Wednesday And Enid by BirbLoverUvU
37 parts Complete Mature
Addams Family Wednesday fanfiction. takes place after the events of the Wednesday series so SPOILERS!. My universe with the ships I use, it's only Wednesday x Enid. 13+ due to language and other things that may trigger people and because it's Wednesday, she's got dark humour and whatnot. it may not entirely be accurate but other than that, enjoy.
𝐒𝐜𝐫𝐞𝐚𝐦, 𝐑𝐨𝐬𝐞𝐭𝐭𝐚 ━━ 𝘸𝘦𝘥𝘯𝘦𝘴𝘥𝘢𝘺 (the original story) by silvxrswift
18 parts Complete Mature
༊*·˚ 𝗶𝗻 𝘄𝗵𝗶𝗰𝗵 𝗿𝗼𝘀𝗲𝘁𝘁𝗮 𝗮𝗱𝗱𝗮𝗺𝘀 𝗷𝗼𝗶𝗻𝘀 𝗵𝗲𝗿 𝘀𝗶𝘀𝘁𝗲𝗿 𝗮𝘁 𝗻𝗲𝘃𝗲𝗿𝗺𝗼𝗿𝗲 𝗮𝗰𝗮𝗱𝗲𝗺𝘆, 𝗵𝗼𝗽𝗶𝗻𝗴 𝘁𝗼 𝗳𝗶𝗻𝗱 𝗹𝗼𝘃𝗲 𝗹𝗶𝗸𝗲 𝗵𝗲𝗿 𝗽𝗮𝗿𝗲𝗻𝘁𝘀, 𝗯𝘂𝘁... 𝗶𝘁 𝘀𝗲𝗲𝗺𝘀 𝗻𝗼𝘁𝗵𝗶𝗻𝗴 𝗯𝘂𝘁 𝗵𝗲𝗮𝗿𝘁𝗮𝗰𝗵𝗲 𝗹𝗶𝗲𝘀 𝗶𝗻 𝘁𝗵𝗲 𝗸𝗶𝗻𝗱 𝗮𝗱𝗱𝗮𝗺𝘀 𝗴𝗶𝗿𝗹'𝘀 𝗳𝘂𝘁𝘂𝗿𝗲 ❝ 𝘪 𝘯𝘦𝘦𝘥 𝘺𝘰𝘶 𝘵𝘰 𝘴𝘤𝘳𝘦𝘢𝘮, 𝘳𝘰𝘴𝘦𝘵𝘵𝘢 𝘢𝘥𝘥𝘢𝘮𝘴. ❞ 𝙬𝙚𝙙𝙣𝙚𝙨𝙙𝙖𝙮, 𝙨𝙚𝙖𝙨𝙤𝙣 𝙤𝙣𝙚 ᶠᵉᵐᵃˡᵉ ᵒᶜ ˣ ʷᵉᵈⁿᵉˢᵈᵃʸ ⁺ ᵐᵒʳᵉ © 𝘴𝘪𝘭𝘷𝘹𝘳𝘴𝘸𝘪𝘧𝘵 , 𝟮𝟬𝟮𝟰
"𝓘 𝓢𝓪𝔀 𝓗𝓮𝓻 𝓑𝓵𝓸𝓸𝓭𝓲𝓮𝓭..." | Male Wednesday ✅ by Julia_Hart90
56 parts Complete Mature
Wednesday would never expect his life to be like his parent. He would even bet on it. Guess he spoke too soon when she walk in his view, pooled in red blood and a nervous smile. Emotions over emotions of something he never felt just washed over him like an untamed sea. And he loves it. ....
wednesday preferences ☾ by camsmp3
56 parts Complete
ON HOLD/NOT WRITING UNTIL SZN 2!!- don't report for infrequent updates please! a preferences book based on the netflix show wednesday none of the characters are mine, all credits to the writers my third ever fanfiction book- tws written in first chapter <3 ... included are: Wednesday Addams Tyler Galpin Enid Sinclair Bianca Barclay Xavier Thorpe Rowan Laslow ( in honor of cady <3 ) Eugene Ottinger Thing Addams Ajax Petropolus Yoko Tanaka Divina Fisher -} i might add more later, it depends on the requests please do consider voting and commenting on each chapter if you can, it really helps me out <3 a/n: ✨ dedicated to : cady, ana, my family and my friends, i love you all 🥥 TW: written in each chapter ... 🦖date started: Feb 4,2023 ( 02/04/23 ) 🦖 Date ended: April 20, 2024 (04/20/24)
Wednesday Oneshots :) by buymesocks
21 parts Complete Mature
I'll write anything you'll request! Don't be afraid to add details to your story :)
You may also like
Slide 1 of 10
this love is good, this love is bad [wenclair] cover
~Thursdays child has vertigo~male Wednesday x reader cover
Purple Haze cover
The Scorned Savior (Harry Potter and the Addams Family) cover
Wenclair one shots ❤️ cover
Wednesday And Enid cover
𝐒𝐜𝐫𝐞𝐚𝐦, 𝐑𝐨𝐬𝐞𝐭𝐭𝐚 ━━ 𝘸𝘦𝘥𝘯𝘦𝘴𝘥𝘢𝘺 (the original story) cover
"𝓘 𝓢𝓪𝔀 𝓗𝓮𝓻 𝓑𝓵𝓸𝓸𝓭𝓲𝓮𝓭..." | Male Wednesday ✅ cover
wednesday preferences ☾ cover
Wednesday Oneshots :) cover

this love is good, this love is bad [wenclair]

64 parts Complete

A wenclair fanfiction that takes place right after the end of season 1. Mostly written from Wednesday's POV. Now that Wednesday has a phone, Enid and her won't stop texting. After a tumultuous first week of summer break, Wednesday spends two weeks in San Francisco with Enid. They were planning on spending the rest of the break at Wednesday's. But Enid also had plans with Ajax ... Both girls know that they are more than friends but only Enid is willing to acknowledge it. *kind of a slow burn* Story is mine, most of the setting/characters aren't. (July '23: editing first chapters)

More details