malcolm in the middle x addams family
ps2vsxbox
  • Reads 19
  • Votes 0
  • Parts 1
  • Time 51m
  • Reads 19
  • Votes 0
  • Parts 1
  • Time 51m
ps2vsxbox
Ongoing, First published Dec 20, 2022
addamsaddamsfamilydeweywilkersonfamilyfanficfanfictionfestergomezgothicmalcolminthemiddelmalcolmwilkersonmorticiapugsleyressewilkersonwednesday
the brothers of malcolm in the middle live with the addams family for 3 days fanfiction
Public Domain
addamsaddamsfamilydeweywilkersonfamilyfanficfanfictionfestergomezgothicmalcolminthemiddelmalcolmwilkersonmorticiapugsleyressewilkersonwednesday
Table of contents

1 part

Sign up to add malcolm in the middle x addams family to your library and receive updates
or
#379addamsfamily
Content Guidelines
You may also like
Boogie/ Xavier Thorpe by Isa-awfull-persone
40 parts Complete
-What happens when the boggie man's great-granddaughter is going to a school for weirdos when Wednesday Addams comes in and stirs up old friendships with a certain artistic boy, will they reconnect or will they become even more strangers- Oc x Xavier Thorpe ⚠️I do not own the show Wednesday or any of the characters only my OC's⚠️
Wednesday And Enid by BirbLoverUvU
37 parts Complete Mature
Addams Family Wednesday fanfiction. takes place after the events of the Wednesday series so SPOILERS!. My universe with the ships I use, it's only Wednesday x Enid. 13+ due to language and other things that may trigger people and because it's Wednesday, she's got dark humour and whatnot. it may not entirely be accurate but other than that, enjoy.
𝐔𝐧𝐥𝐢𝐤𝐞𝐥𝐲 𝐂𝐢𝐫𝐜𝐮𝐦𝐬𝐭𝐚𝐧𝐜𝐞 || Wednesday x Male Reader by Rozzychill
2 parts Ongoing Mature
Purple Haze by fairytail_4_the_win
21 parts Ongoing Mature
M! Wednesday Addams x F! OC In which, the Craven siblings are sent to the Addams' manoir to steal the family's fortune. Neither knew what was to come. Or Where the oldest Addams' son's heartstrings were pulled by a pair of purple eyes and a heart-shaped smile. Or Where, the youngest Craven daughter's soul was pulled by a pair of cold eyes and a deep voice, the plan was instantly forgotten. FYI this is a fast pace and love at first sight type of book. If you don't like either I recommend not reading if you don't enjoy those types of books. I DON'T OWN ANYTHING OF THE ADDAMS FAMILY! I ONLY OWN MY OC'S AND THEIR BACKSTORIES!
Wednesday Oneshots :) by buymesocks
21 parts Complete Mature
I'll write anything you'll request! Don't be afraid to add details to your story :)
𝙺𝚘𝚒𝚗𝚘𝚙𝚑𝚘𝚋𝚒𝚊 by StrawH0e
19 parts Ongoing Mature
The fear of living an ordinary life. Addams Family fanfic OC x OC Highest Rankings🥇 #1 in OC X OC. 9.25.24 #1 in AddamsFamilyValues. 9.25.24 #1 in black OC. 9.30.24 #1 in Gomez. 10.10.24 #1 in Thing. 10.16.24 #1 in Pugsley. 10.16.24 #1 in Addams. 11.8.24 #1 in lurch. 11.8.24
Wenclair one shots ❤️ by AAndrophobia
108 parts Ongoing Mature
Wenclair oneshot stories|| leave suggestions Status- semi/full hiatus until Wednesday season 2 1k hashtags #2 Addamsfamily 10/2/23 #4 wenclair 10/2/23 #4 goth 10/4/23 #1 recommend 12/22/23 #1 preppy 01/6/24 #6 Addamsfamily 03/1/24 #12 gomez 06/24/24 #3 jennaortega 8/17/24 #3 kinks 10/16/24 #1 WednesdayAddams 11/11/24
sᴋᴇʟᴇᴛᴏɴ & ғʟᴏᴡᴇʀs [ᴍᴀʟᴇ ᴡᴇᴅɴᴇsᴅᴀʏ] by Sailormoonuzumaki
24 parts Complete Mature
"𝘾𝙡𝙤𝙨𝙚, 𝙨𝙚𝙭 𝙖𝙣𝙙 𝙃𝙤𝙢𝙞𝙘𝙞𝙙𝙚" "𝙏𝙝𝙚 𝙤𝙣𝙡𝙮 𝙥𝙚𝙧𝙨𝙤𝙣 𝙩𝙝𝙖𝙩 𝙜𝙚𝙩𝙨 𝙩𝙤 𝙩𝙤𝙧𝙩𝙪𝙧𝙚 𝙢𝙮 𝙗𝙤𝙮𝙛𝙧𝙞𝙚𝙣𝙙 𝙞𝙨 𝙢𝙚." Oc x male Wednesday
You may also like
Slide 1 of 8
Boogie/ Xavier Thorpe cover
Wednesday And Enid cover
𝐔𝐧𝐥𝐢𝐤𝐞𝐥𝐲 𝐂𝐢𝐫𝐜𝐮𝐦𝐬𝐭𝐚𝐧𝐜𝐞 || Wednesday x Male Reader cover
Purple Haze cover
Wednesday Oneshots :) cover
𝙺𝚘𝚒𝚗𝚘𝚙𝚑𝚘𝚋𝚒𝚊 cover
Wenclair one shots ❤️ cover
sᴋᴇʟᴇᴛᴏɴ & ғʟᴏᴡᴇʀs [ᴍᴀʟᴇ ᴡᴇᴅɴᴇsᴅᴀʏ] cover

Boogie/ Xavier Thorpe

40 parts Complete

-What happens when the boggie man's great-granddaughter is going to a school for weirdos when Wednesday Addams comes in and stirs up old friendships with a certain artistic boy, will they reconnect or will they become even more strangers- Oc x Xavier Thorpe ⚠️I do not own the show Wednesday or any of the characters only my OC's⚠️

More details