Story cover for The Last Hope-->Self-published Amazon/Kindle book by Yozrelbooks
The Last Hope-->Self-published Amazon/Kindle book
Yozrelbooks
  • WpView
    Reads 142,110
  • WpVote
    Votes 1,165
  • WpPart
    Parts 7
  • WpHistory
    Time 55m
  • WpView
    Reads 142,110
  • WpVote
    Votes 1,165
  • WpPart
    Parts 7
  • WpHistory
    Time 55m
Yozrelbooks
Complete, First published Dec 26, 2022
Mature
brothersdarkdarkromanceescapefamilykidnappedlieslovemafiamafiaromancemotherromancerussiansaviorsisterssonstortured
/Mature and unsuitable content for young audience./

The Last Hope, the Ivanov brothers book 1.


Trapped by one of the most dangerous men in the Italian mafia, Selina isn't living-she's merely surviving. Until the day she escapes, her son in her arms, hunted by an enemy who refuses to let her go.

Her only hope? Nikolai Ivanov, the ruthless Russian mob-an equally dangerous yet mesmerizing man. But offering Selina his protection means declaring war. Between power struggles, shattered alliances, and forbidden desires, Selina must make a choice: face her past... or be consumed by the darkness of the underworld.

Selina & Nikolai
All Rights Reserved
brothersdarkdarkromanceescapefamilykidnappedlieslovemafiamafiaromancemotherromancerussiansaviorsisterssonstortured
Table of contents

7 parts

Sign up to add The Last Hope-->Self-published Amazon/Kindle book to your library and receive updates
or
Content Guidelines
You may also like
𝐑𝐄𝐕𝐀𝐌𝐏𝐈𝐍𝐆 |✍ | 𝐁𝐔𝐑𝐍 𝐅𝐎𝐑 𝐘𝐎𝐔 | 𝐎𝐑𝐈𝐆𝐈𝐍𝐀𝐋 by books__and__coffee
15 parts Ongoing Mature
❝𝒱𝒾𝒸𝓉𝑜𝓇𝒾𝒶, 𝓉𝒽𝑒 𝓆𝓊𝑒𝑒𝓃 𝑜𝒻 𝓂𝓎 𝒽𝑒𝒶𝓇𝓉 𝒶𝓃𝒹 𝓂𝓎 𝑒𝓂𝓅𝒾𝓇𝑒.❞ ˜*°• 𝐈𝐍 𝐖𝐇𝐈𝐂𝐇 Victoria Russo grew up in a world full of money, crime and powerful families. Being a part of the Sacred Eight families, she knew what it meant to be on the top of the food chain, but she never knew what it could cost her. DARK MAFIA ROMANCE. 18+. READ IT AT YOUR OWN RISK. © All rights belong to me.
Devour Me by elleandlahwrites
21 parts Complete Mature
When you set your eyes on two innocent eyes, you are drawn into a world of darkness unlike anything you've seen. I mean, I'm aware that this world doesn't inhabit sunshine and rainbows, but knowing and experiencing are two different games. This story follows Leilanni as she must decide to sacrifice for the devil, who has lured her with the use of an angel. _________ ׂׂૢ་༘࿐_________ ׂׂૢ་༘࿐_________ ׂׂૢ་༘࿐_________ ׂׂૢ་༘࿐_________ ׂׂૢ་༘ WARNINGS This book is a mafia book. This is a BWWM book. This is a DARK ROMANCE if you don't like them don't read it. Violence and other graphic themes will be portrayed in this book DON'T READ IF YOU ARE SENSITIVE TO SUCH. 18+ ........ Enjoy the book and thanks for clicking mwah😽💖🤍
Deadly Alliances by Reversebacktoyou
37 parts Complete Mature
Deadly Books: Book 1 "Why is it fun to belittle yourself, Flynn?" Juliette whispered, circling him slowly while dragging her finger across his chest and back. "It's not," he whispered back. She paused in front of him, tugging his head to look at her. "But you know the consequences of your actions, correct?" "Enlighten me," he said lowly. -------------------------------------- Juliette Ivanov is a confused 21-year-old woman who is arranged to marry the enemy in order to teach her to handle her emotions and settle down. Flynn Collins is an overworked guy who's constantly pressured to step into his role and marry the enemy to prove himself worthy of being the boss. But together, they are one psychopathic couple that doesn't care what anyone thinks because they have each other. *Mature Content* ---------------------------- "Do you trust me, Juliette?" he asked. "With my life."
Devils Daughter | ✔︎| PUBLISHED| by sinfulxhaze
67 parts Complete Mature
(18+) ( editing ) "I want it slow baby." he whispers, planting dozens of kisses on my neck as I ride him. "How slow?" I breathe. "Slow enough so that I can feel you entering my soul." He whispers and steals another kiss from me. ❦ The daughter of a Russian mob leader seems to catch the eye of his father's enemy. Will the Italian Don use The Russian Don's daughter as his plan to destroy his rival and fall in love with her or the father finds out himself and kills them both? - 'The Italian Don and his enemies daughter' [Mature Audience Only] HIGEST RANKINGS # 1 Romance -16/04/2021 # 1 Temptation -08/08/2021 # 1 Eyesslipfierce - 09/07/2022 # 1 Wild - 13/09/2022 # 1 Bad - 22/09/2022
Grey & Eve by LiliHiches
51 parts Complete Mature
The Kings' and Monroes' lost their everything in a span of one night. Their parents were killed leaving the King's little brother and the Monroe's little princes to be taken under the cover of the dark. Years later the two powerful families have joined their forces and would stop at nothing to bring their little prince and princess back home. But what they don't know is that Greyson and Genevieve have been caring and protecting each other through their darkest and toughest times. So what will happen when the dark nights are finally o ver and they both return home to their families with the arrival of an unexpected guest with them!? Read to find out! (Complete) ------------------------------ #2 ~ mafia family (01-06-22) #1~ brother (20-08-22) #1~ friends to lovers (27-09-22) #1 ~ orphan (25-07-22) #1~only girl (25-09-22) #1~ sister and brother (25-06-22) #1~girlfriend (07-08-22) #1~mafia family (22-08-22)
Metanoia by Elijahtheshagger
55 parts Complete
Metanoia (n.) the journey of changing one's mind, heart, self or way of life. Part one Darcy Russo a nine year old girl living in a run down orphanage on the outskirts of Athens, Greece has had to fend for herself for the majority of her life. Being abandoned as a child and having to endure cruelty and abuse from those who were supposed to look after her has caused her to become untrusting and wary of others. Instead she seeks solace in nature, spending any and all free time exploring the wilderness and the ocean with her dog Bear. Although Darcy has accepted that she can only depend on herself, what happens when she finds out that she wasn't abandoned she was taken and her eight older brothers will stop at nothing to get her back. Part two After being kidnapped by the Russian mafia and tortured for years for information she doesn't have, Darcy Russo becomes cold and calculated. When the leader of the Russian mafia Ivan Volkov offers her a deal, train and work for him as an assassin or die, she can't exactly refuse. Being nicknamed 'Sin' by the underworld, she changes her identity and becomes a ruthless, efficient killer. But what happens when she is sent on a mission to destroy the family she once loved. Will she let the resentment she has for them for being the reason she was tortured take over or will she spare their lives? And what happens when she catches the attention of her brother's best friend.
𝐓𝐈𝐋𝐋 𝐃𝐄𝐀𝐓𝐇 𝐃𝐎 𝐔𝐒 𝐏𝐀𝐑𝐓 - 𝟏𝟖+ by averymarinoxo
36 parts Complete Mature
- 𝐔𝐍𝐅𝐎𝐑𝐆𝐈𝐕𝐄𝐍 𝐒𝐎𝐔𝐕𝐄𝐍𝐈𝐑𝐒 𝐎𝐍𝐄 -A second-chance enemies-to-lovers mafia romance- 'Till death do us part' was so much more than a vow for them It was Keira's refuge, Nikolai's sanity, and their redemption. Keira fell hard, they loved harder, but her secrets were closing in, and when she died in his arms, he'd hoped he did too. Except he never could have imagined that the wife he'd been morning for eight years was alive. He wanted to break her for ruining him. She vowed to fight him for it. However, they didn't consider that it was no longer about them. They had enemies who were waiting, empires built on blood, and in their passion filled games they forgot that all it would take was one breath for both of their lies and deciet to catch up, and destroy everything they weren't ready to lose all over again. ♤ ♡ ◇ ♧ Copyrights© 2020 @averymarinoxo All rights reserved. Warning: This story is a dark mafia romance. It contains substance abuse, explicitly sexual scenes, and violence. Reader discretion is advised.
The Edge of Light by chuppauthor
38 parts Complete Mature
In a world built on lies, violence, and power, there's no room for softness-especially not in the hearts of those who rule. Nikolai, a ruthless mafia kingpin hardened by betrayal and tragedy, has never questioned his grip on control. That is until Elena, a woman born into a life of privilege yet haunted by her own darkness, crosses into his domain. Torn between their fierce attraction and the impossibility of love in their deadly world, they find themselves bound by secrets neither is prepared to reveal. But when betrayal strikes, and Elena seizes a fleeting chance at freedom, Nikolai's world threatens to unravel. Obsessed with her every move, he's forced to confront his deepest fear: has his love become a cage? And if so, can either of them truly escape? Danger, desire, and deception collide in this heart-pounding mafia romance, where loyalty means everything-and nothing is what it seems.
His world by Catmoms_Library
23 parts Complete Mature
(Book 1 of His Mafia series) My lover, Stefano. I was so captivated by his love and lust I let the most obvious details slip through the cracks. I believed his lie without question, blindly, almost getting myself killed. He kept me a secret for my own protection... only they found me. They came for me, forcing me into his world. I expected to find darkness, a hell on earth full of evil. But I didn't, I found a home, an ex-lover, and myself. I hid her away when I knew they'd come for her. When I met Annalise they already gotten my sister-in-law. I didn't want her to have the same fate. Sergei, the Russian mafia leader targeted us for power. My heart stopped when I heard her scream, they'd found her. I had no other choice than to pull her into my world, and hope that she wouldn't leave.
𝗠𝗶𝗹𝗮 by juliawritesss
19 parts Ongoing Mature
"𝗔𝘀 𝗹𝗼𝗻𝗴 𝗮𝘀 𝘄𝗲 𝘀𝗵𝗮𝗿𝗲 𝘁𝗵𝗲 𝘀𝗮𝗺𝗲 𝘀𝗸𝘆 𝗮𝗻𝗱 𝗯𝗿𝗲𝗮𝘁𝗵 𝘁𝗵𝗲 𝘀𝗮𝗺𝗲 𝗮𝗶𝗿, 𝘄𝗲'𝗿𝗲 𝘀𝘁𝗶𝗹𝗹 𝘁𝗼𝗴𝗲𝘁𝗵𝗲𝗿." After being through a lifetime of trauma Milana Alyona Vasiliev finally feels like she can breath as relief envelopes her into its sweet embrace. But like everything, it is short lived as a new piece of information changes everything she thought she knew. All the sweet lies she had been told finally unfold to present a bittersweet truth, one that she could never expect in all the years she has lived. It could be a chance to move on and to finally have something she craved so much, a family. But the longer she stares at those who hold her future in their grasps, she realizes that even though her future wasn't the brightest, it was a known evil. Now she dives into the unknown and can only hope she can survive. And if you throw trauma, secrets, utter chaos, friendship and love into a perfect mix, there's no way of knowing if it'll turn out well. For once Milana has no idea if she'll be able to face what awaits her.
You may also like
Slide 1 of 10
𝐑𝐄𝐕𝐀𝐌𝐏𝐈𝐍𝐆 |✍ | 𝐁𝐔𝐑𝐍 𝐅𝐎𝐑 𝐘𝐎𝐔 | 𝐎𝐑𝐈𝐆𝐈𝐍𝐀𝐋 cover
Devour Me cover
Deadly Alliances cover
Devils Daughter | ✔︎| PUBLISHED| cover
Grey & Eve cover
Metanoia cover
𝐓𝐈𝐋𝐋 𝐃𝐄𝐀𝐓𝐇 𝐃𝐎 𝐔𝐒 𝐏𝐀𝐑𝐓 - 𝟏𝟖+ cover
The Edge of Light cover
His world cover
𝗠𝗶𝗹𝗮 cover

𝐑𝐄𝐕𝐀𝐌𝐏𝐈𝐍𝐆 |✍ | 𝐁𝐔𝐑𝐍 𝐅𝐎𝐑 𝐘𝐎𝐔 | 𝐎𝐑𝐈𝐆𝐈𝐍𝐀𝐋

15 parts Ongoing Mature

❝𝒱𝒾𝒸𝓉𝑜𝓇𝒾𝒶, 𝓉𝒽𝑒 𝓆𝓊𝑒𝑒𝓃 𝑜𝒻 𝓂𝓎 𝒽𝑒𝒶𝓇𝓉 𝒶𝓃𝒹 𝓂𝓎 𝑒𝓂𝓅𝒾𝓇𝑒.❞ ˜*°• 𝐈𝐍 𝐖𝐇𝐈𝐂𝐇 Victoria Russo grew up in a world full of money, crime and powerful families. Being a part of the Sacred Eight families, she knew what it meant to be on the top of the food chain, but she never knew what it could cost her. DARK MAFIA ROMANCE. 18+. READ IT AT YOUR OWN RISK. © All rights belong to me.

More details