Story cover for The Hero's Guide (Link X Reader) by really_lily
The Hero's Guide (Link X Reader)
really_lily
  • WpView
    Reads 558
  • WpVote
    Votes 17
  • WpPart
    Parts 2
  • WpHistory
    Time 55m
  • WpView
    Reads 558
  • WpVote
    Votes 17
  • WpPart
    Parts 2
  • WpHistory
    Time 55m
really_lily
Ongoing, First published Jan 11, 2023
angstangstwithhappyendingbotwbreathofthewildfanfictionhyrulewarriorsinjurylegendofzeldalinklinkeduniverselinkxreaderlozmajorasmaskmiphaocarinaoftimeselfinserttwilightprincessynstorieszelda
Princess (Y/N), second heir to the throne of Hyrule, is adopted. Seemingly from another world, she feels left out and isolated. On the night of her 18th birthday, an accident occurs and she's transported to another time, along with her sister's knight: Link. Together they meet 8 heroes, who for some reason, recognize (Y/N) as the sacred hero's guide. She has no recollections of who these men are, but travels with them in hopes of both her and Link, can return home- before the calamity breaks loose.
All Rights Reserved
angstangstwithhappyendingbotwbreathofthewildfanfictionhyrulewarriorsinjurylegendofzeldalinklinkeduniverselinkxreaderlozmajorasmaskmiphaocarinaoftimeselfinserttwilightprincessynstorieszelda
Table of contents

2 parts

Sign up to add The Hero's Guide (Link X Reader) to your library and receive updates
or
#74hyrulewarriors
Content Guidelines
You may also like
Heart of the Yiga (Princess Zelda x Male Reader) by Shadysheep06
29 parts Complete Mature
Y/n L/n has been raised by the Yiga Clan after they found him abandoned as a baby, he is one of the strongest and youngest members of the Yiga due to his skill in combat which is far greater than any of his fellow Yiga. Gossip among the clan is spreading about you being the Yiga to finally kill that pesky "hero" but will you be able to rise to the challenge or will something... Or someone get in your way? DISCLAIMER, All characters (except Y/n and Ooma) are owned by Nintendo.* DISCLAIMER, I do not own any of the art used in this story.*
... by TheTrueTVFG
33 parts Complete
The Letter -- A Zelink Fanfiction by ZeldaLegend1986
6 parts Complete
A Post-Calamity Zelink Fanfiction. After Zelda finds a letter she had somehow missed, she and Link must travel to Zora's Domain and address the problem with the Divine Beast before the Domain is laid to ruin. However, Zelda is tired of Link constantly getting hurt to protect her and no matter how many times she tells him, it does not seem to make a difference. Will they be separated because of his recklessness, or will it bring them closer together? Disclaimer: This story does contain violence and blood. All Rights to The Legend of Zelda belong to Nintendo The cover art is not my own and the rights go to the creators
An Ally Found In The Graveyard: A Legend of Zelda: Twilight Princess Story by g0thchick00
10 parts Ongoing Mature
Hyrule is threatened once again by Zant and Ganondorf, newly crowned, Queen Zelda is on the verge of surrender, and Link, the hero from Ordon Village is called for aid. Upon arriving at Castle Town, Link is immediately overwhelmed by the forces of monsters that have forced the townsfolk into hiding. He realizes that he will not defeat Hyrule's foes without help so he sets off for Kakariko Village to find allies. Y/n, a girl who lives in Kakariko Village was not well accepted in the village. You are an outsider, no one knows where you came from. Protecting those around you became something you dedicated yourself to. You trained yourself to fight in the graveyard for days until your body gave out and you'd start again. One day, Link finds you battling a lone goblin that has infiltrated the village by yourself. Impressed by your natural skill, he brings you along to gather more allies from all other villages. The more time the two of you spend with each other, you both slowly fall in love, then your deepest secret is revealed. *All character and village names go to Nintendo*
A Breath of You (Link X Reader) by catfishhamsterlady
34 parts Complete Mature
Dear Journal, Impa told me that writing this after Link passed would help me heal. Heal in what way? I don't want to heal, I don't even want to live. Link was my everything. I haven't seen him in weeks and suddenly he's dead? I should've been a good wife. I should have stayed by his side and fought. I wish it were me. I wish I died instead. He's the hero, he should be alive. I miss him so much. (Y/n) has remained alive for 100 years. One hundred painstaking years. Each year that ticks by, she has no idea why she lives. That is until strange towers rose from the ground and ancient shrines lit up across Hyrule. When (Y/n) returns to Impa to ask, she finds the answer. Her fiancé. Her dead fiancé had come back to life with no memories at all. A Breath of You (Link x Reader) Breath of the Wild! #1 for the tag Breath of the Wild #1 FOR LINK X READER BABY LETS GO! THANK YOU GUYS SO SO MUCH! #2 FOR LEGEND OF ZELDA TAG I LOVE YALL This is fully completed! May 12th, 2023 <3 (Y/n)- your name (E/c)- eye color (H/c) - hair color
The Silent Princess - A Breath Of The Wild Fanfiction by Ellieaziya
62 parts Complete
Time has passed. Hyrule is getting rebuilt. Zelda on the other hand is not quite sure what to do. She is no longer a princess, She's a queen with responsibilities. A dark force is looming. Old friends are getting rediscovered but that boy. That man. Link. There's an unfinished story with him. This is my take on the universe. There will be new characters that aren't canon. There will be a few POV swaps but let's see if I can make this a cohesive story.
A Blood Soaked Tale (TP Link x Reader x BOTW Link x SS Link!) by ShizukaKioko
9 parts Complete
(Y/n), thought she knew her friends.. But she doesn't know everything about them.. When she does learn their secret, how will she react? (Assassin! Breath Of The Wild Link x reader x Assassin! Twilight Princess Link x Assassin! Skyward Sword Link!) [Kinda Updated-] I don't own any of the Link's, or any of the characters that are mentioned in my story the original owners are Nintendo. And I don't own you! I only own the plot. ( I may have two or three OC's in here.. ;) (I don't own the fanart ether. So, credit to the original artist! Oh, yeah. And, incase you couldn't already tell, the story was also inspired by, 'Assassin's Creed'! ^^ If you haven't played it, then I suggest ya do!.. But, ya don't have to..)
𝐓𝐰𝐢𝐧 𝐨𝐟 𝐖𝐢𝐬𝐝𝐨𝐦 | 𝘉𝘰𝘵𝘞 𝘓𝘪𝘯𝘬 𝘹 𝘙𝘦𝘢𝘥𝘦𝘳 by SpongeWritesStuff
16 parts Ongoing
ׂ╰┈➤𝐅!𝐑𝐞𝐚𝐝𝐞𝐫𝐱𝐋𝐢𝐧𝐤* The Hyrulean Royal family found themselves in quite the predicament on the day the Queen of Hyrule gave birth to twins-two healthy, beautiful baby girls. They named the first daughter Zelda, hoping the Goddess Hylia would answer their prayers and keep the tradition of her unlocked the sacred power to seal Calamity Ganon. The second daughter, (Y/n), was hidden from the public eye at the request of the King. Zelda spent almost her whole life with government studies and prayer being stuffed into her face, her personal passions being frowned upon. (Y/n), on the other hand, had no duties to fulfill and instead studied alongside her sister, became a knight, and made a certain special friend. Despite having a place among those she's closest to, she still feels confused, as if something in her life quite hasn't clicked into place yet... ...that is, until her entire world crumbles whenever she realizes that her true purpose is that of which her sister had been promised her entire life. 𝙒𝙤𝙧𝙙 𝘾𝙤𝙪𝙣𝙩: 𝐓𝐁𝐃 𝙋𝙖𝙨𝙩 𝙍𝙖𝙣𝙠𝙞𝙣𝙜𝙨: #1 in thelegendofzelda #1 in link #1 in linkxreader #1 in breathofthewild #1 in botw #1 in totk #1 in ageofcalamity #1 in hyrulewarriors #1 in zeldafanfiction #1 in hyrule #1 in ganon #1 in hylia #1 in nintendo 𝟎𝟕/𝟐𝟕/𝟐𝟐 ┈➤ ??? *𝘛𝘩𝘦 𝘧𝘪𝘳𝘴𝘵 𝘧𝘦𝘸 𝘤𝘩𝘢𝘱𝘵𝘦𝘳𝘴 𝘰𝘧 𝘵𝘩𝘪𝘴 𝘸𝘰𝘳𝘬 𝘸𝘦𝘳𝘦 𝘱𝘳𝘦𝘷𝘪𝘰𝘶𝘴𝘭𝘺 𝘱𝘶𝘣𝘭𝘪𝘴𝘩𝘦𝘥 𝘺𝘦𝘢𝘳𝘴 𝘱𝘳𝘪𝘰𝘳, 𝘣𝘶𝘵 𝘩𝘢𝘷𝘦 𝘴𝘪𝘯𝘤𝘦 𝘣𝘦𝘦𝘯 𝘳𝘦𝘸𝘳𝘪𝘵𝘵𝘦𝘯 𝘢𝘯𝘥 𝘳𝘦𝘱𝘶𝘣𝘭𝘪𝘴𝘩𝘦𝘥.
Tears of the Deity by jp_druma_boy
19 parts Complete
Link, the Hero of Hyrule, has just learned of Princess Zelda's fate after seeing the final dragon tear. Overcome with grief, he sets out to seek a legendary power, one he believes will guarantee Hyrule's victory...and his revenge. But will he lose himself in the process? A HUGE thank you and shout out to @fire_bird_ana for making the cover art for this fan fic! She has some incredible LOZ art you should check out, as well as her own fan fic that I highly recommend. Author's note: This story takes place during Tears of the Kingdom, right after Link discovers the last of the dragon tears. It combines elements from that story, in addition to some of my other favorite Legend of Zelda games. Though I generally try to stay true to lore, at times I made adjustments to help things flow. I don't claim to be a professional author or Legend of Zelda expert, I just wrote a story that I would enjoy. *I do not own any characters used in this story. All rights to Nintendo. *The pictures before each chapter are screen shots from Tears of the Kingdom.
You may also like
Slide 1 of 9
Heart of the Yiga (Princess Zelda x Male Reader) cover
... cover
The Letter -- A Zelink Fanfiction cover
An Ally Found In The Graveyard: A Legend of Zelda: Twilight Princess Story cover
A Breath of You (Link X Reader) cover
The Silent Princess - A Breath Of The Wild Fanfiction cover
A Blood Soaked Tale (TP Link x Reader x BOTW Link x SS Link!) cover
𝐓𝐰𝐢𝐧 𝐨𝐟 𝐖𝐢𝐬𝐝𝐨𝐦 | 𝘉𝘰𝘵𝘞 𝘓𝘪𝘯𝘬 𝘹 𝘙𝘦𝘢𝘥𝘦𝘳 cover
Tears of the Deity cover

Heart of the Yiga (Princess Zelda x Male Reader)

29 parts Complete Mature

Y/n L/n has been raised by the Yiga Clan after they found him abandoned as a baby, he is one of the strongest and youngest members of the Yiga due to his skill in combat which is far greater than any of his fellow Yiga. Gossip among the clan is spreading about you being the Yiga to finally kill that pesky "hero" but will you be able to rise to the challenge or will something... Or someone get in your way? DISCLAIMER, All characters (except Y/n and Ooma) are owned by Nintendo.* DISCLAIMER, I do not own any of the art used in this story.*

More details