god's dream ; a graphic shop
PittieLau
  • Reads 19,730
  • Votes 3,896
  • Parts 67
  • Time 38m
  • Reads 19,730
  • Votes 3,896
  • Parts 67
  • Time 38m
PittieLau
Ongoing, First published Jan 23, 2023
1 new part
bookbookcoverbookcoverdesigncoverdarkdesignfantasygraphicgraphicshopidolkpopmanipulationmysteryshop
☄ god's dreams ' 𝑏𝑦 𝑝𝑖𝑡𝑡𝑖𝑒𝑙𝑎𝑢 CLOSE!!
დ batch one : close.
დ  batch two :  close.
დ batch three : close.
 დ batch four  : close.


―   You can learn about the rules by reading the first chapter. Everyone is invited to heaven. 〞⊸ↀ


start : 28.05.2023
finish : ?

©pittielau2023
All Rights Reserved
bookbookcoverbookcoverdesigncoverdarkdesignfantasygraphicgraphicshopidolkpopmanipulationmysteryshop
Table of contents

67 parts

Sign up to add god's dream ; a graphic shop to your library and receive updates
or
#46cover
Content Guidelines
You may also like
අපි අපේ by M_P_Asu
37 parts Ongoing
අසම්මතේකිනුත් අසම්මතයක් උන අපේ ආදර කතාව දැන ගන්න ඔයත් එකතු වෙන්න
𝘀𝗲𝗾𝘂𝗲𝗻𝗰𝗲 ˒ ೀ oc gg by acubiwinter
2 parts Ongoing
⌈ღ⌋ ❛❛ in which evermore entertainment, a yg entertainment subsidary, debuts the 4 member girl group, sequence ! ❜❜ 𝘀𝘁𝗮𝘁𝘂𝘀 : ONGOING ✓
•The lost Russo• by Grogudindjarin
15 parts Ongoing
°A boy who is just a 7 Years old, who looks so much like a 5 and half years old boy , being abused by his stepfather, neglected by his mother ,relaying on his crutches to move , can't say a sentence without stuttering , is finally with his family agian , will he trust them? __________________________________________________ The Russo family lost their youngest member 5 years ago , Now he is back with them but he is not their sunshine anymore , Now he is a broken boy that saw much in his life , A boy that can't walk without his crutches , How will they help him , How will they save and protect him from their mafia and buisness world? __________________________________________________ It was always about a young abused girl finding her family , Now what if it was a boy?
යොවුන් ආදර වසන්තේ by _dolie_
26 parts Ongoing
"ඕයි ඕයි වහිනවා තෙමෙනවා නැගිටපල්ලා වෙන කොහෙට හරි ගිහින් ගහගමු... වරෙන් යකෝ යන්න මට තෙමෙන්න බෑ පීනසෙත් තියෙනවා..!! ඒර්ර්ර්ර්ර්ර්‍ අනේ රඛිතයා උඹවත් මුන්ට කියපන්කො මට පෙසරුත් නගිනවාහ්හ්!!" *** ~තාරුණ්‍යයේ ජවය හිස මත තබාගත් සෙල්ලක්කාර, විසේකාර,ආඩම්බර, අහංකාර යෞවනයන් සිව් දෙනෙක්.. මේ ඔවුන්ගේ කතාව~ ||යොවුන් ආදර වසන්තේ|| written by, _Dolie_
She's My Best Friend. -A Chandler Riggs love story by iiCatchingStars
20 parts Complete
Amelia was Trying to Get a role on AMC'S "The Walking Dead." For a new Character Called Max. Maggie and Glenn's Adopted Daughter. Will Chandler Fall in Love with Amelia or will He get Friend zoned? Read to find out!
නසරාණියා|Nasaraniya by HinchiPinchi20
64 parts Ongoing
"කේතුර් දන්නවද මම කේතු‍ර්ට කොච්චරක් ආදරෙයි කියල ?" "හැමතිස්සෙම වචනෙන් නොකිව්වත් සර්ගෙ ඇස් මගේ ඇස් එක්ක පැටලෙනකොට ඒ දිලිසෙන ඇස්වලින් මට පේනවා සර් මට කොච්චර ආදරෙයිද කියලා." ආදරේ වැඩියෙන්ම දැනුනේ මගහැරුණු හිත්වලට....ආදරේ වැඩියෙන්ම කරෙත් ඒ මගහැරුණු හිත්මයි. #3 in care out of 123k stories #1 In Boylove #3 in friendships #1 in stress #2 in funny out of 9.37k stories #33 in Care #3 in teacherxstudent #3 in stress out of 7.2k stories #6 in friendship out of 236k stories Start-2023/11/21 End-
Stephanie Rose's Writer Room - It's Not All Roses by StephRose1201
20 parts Ongoing
♥ A Writer's Journal ♥ Where readers can get to know me, Stephanie Rose, through my writing processes, my multiple projects, and my passing thoughts. Where I answer questions -- those asked by my readers or myself -- and share behind-the-scenes info on my characters, story ideas, aesthetic choices. Where I share my projects, my woes, my hopes, my dreams. Where I bring you, the reader, into my world -- the world of an author. ♥ this is a story with PAID CHAPTERS, except for the first two. Please consider unlocking chapters to read more about me! There will be bonus things that *aren't* included in any of the stories posted on Wattpad! ♥
Beacon Hills: 10 Years Later by enny395
12 parts Complete
It has been 10 Years since Scott's pack has left Beacon Hills. See what their lives have become.
The Lantern [Brian Jones] by mistinthemirror
6 parts Complete
Accidents happen all the time. Sometimes we survive and sometimes we don't.
𝗩𝗔𝗟𝗘𝗥𝗜𝗔𝗡 - ᴘʟᴏᴛꜱʜᴏᴘ by AlexandraWB
90 parts Ongoing
込░ ， ⏤ 𝗩𝗔𝗟𝗘𝗥𝗜𝗔𝗡 𓄲 ͠٭ ᰥ❫ a.... [plotshop book] ═════════════ (ʙʏ ᴘᴀʀᴋᴇʀ) "Ꭰᴏɴᴅᴇ Me aburro mucho y en vez de empezar historias que no voy a terminar te las regalo" Ꮎ "Ꭼɴ ᴅᴏɴᴅᴇ Te doy gran variedad de ideas que puedes usar para tus historias" 𝄇 Abierta 𝄇 Con un gráfico de regalo 𝄇 By AlexandraWB
You may also like
Slide 1 of 10
අපි අපේ cover
𝘀𝗲𝗾𝘂𝗲𝗻𝗰𝗲 ˒ ೀ oc gg cover
•The lost Russo• cover
යොවුන් ආදර වසන්තේ cover
She's My Best Friend. -A Chandler Riggs love story cover
නසරාණියා|Nasaraniya cover
Stephanie Rose's Writer Room - It's Not All Roses cover
Beacon Hills: 10 Years Later cover
The Lantern [Brian Jones] cover
𝗩𝗔𝗟𝗘𝗥𝗜𝗔𝗡 - ᴘʟᴏᴛꜱʜᴏᴘ cover

අපි අපේ

37 parts Ongoing

අසම්මතේකිනුත් අසම්මතයක් උන අපේ ආදර කතාව දැන ගන්න ඔයත් එකතු වෙන්න

More details