Twilight and Midnight Sun
euphoriakissed
  • Reads 526
  • Votes 2
  • Parts 17
  • Time 6h 31m
  • Reads 526
  • Votes 2
  • Parts 17
  • Time 6h 31m
euphoriakissed
Ongoing, First published Feb 07, 2023
anddedwardbellabellaswanedwardcullenedwardspovlifeanddeathmidnightsunstephaniemeyertwilighttwilightfanstwilightsaga
Have you read Twilight? And have you read Midnight Sun? Bella's point of view, and then Edwards? 

Read them both now, one POV right after the other! 

(I WOULD JUST LIKE TO SAY I TAKE NO CREDIT AT ALL FOR ANY OF THE WRITING, THIS IS ALL STEPHANIE MEYER! ONLY THING I DID WAS PUT IT ALL IN ORDER SO YOU CAN EXPERIENCE BOTH NOVELS AT THE SAME TIME)
Public Domain
anddedwardbellabellaswanedwardcullenedwardspovlifeanddeathmidnightsunstephaniemeyertwilighttwilightfanstwilightsaga
Table of contents

17 parts

Sign up to add Twilight and Midnight Sun to your library and receive updates
or
#29lifeanddeath
Content Guidelines
You may also like
Monster (Twilight X Reader) by jxckson-wxng
22 parts Complete
After a night (Y/N) (L/N) was attacked by a monster of some sort, things were never going to be the same. In order to gain control of herself, she must pretend it didn't happen and lie when she asks her cousin, Bella, for help. So she leaves from New York City to Forks, Washington only to meet people that may be more of use than harm. When she gets stuck in the world of immortals and wolves, she learns more about what she's capable of, and how she can prevent others from harming those she loves. Note: This is a Jasper x Reader x Jacob, but I put it under Twilight x Reader. Update: THIS SERIES IS DISCONTINUED. I'm so sorry I always wanted to get back to this but I kept procrastinating until I eventually forgot. this first book is complete and there's parts of the second but no satisfying ending. Don't read if you don't want to be disappointed :(
Her Humanity by AnnShree04
51 parts Complete
Bella Swan's younger sister comes to town to live with her and Charlie forever. Bella is depressed after the Cullen's up and left her in the dust. But she's coping with Jacob and the Pack. Now Bella is stressed over keeping secrets from her sister and father now. What happens when she falls in love with the big bad hybrid? The journey begins within this story... Keep reading to find out! * Disclaimer I own nothing that is twilight original. It all belongs to Stephanie Meyers and I don't own TVD character or story line. The different things through the story that isn't original is mine.*
tough | b.swan by kiraalicex
35 parts Complete
NOT A BELLA LOVE STORY FFS READ THE BIOOO I love being a twin. It has always been so much fun having a birthday party to share with someone, always having someone across the room if I had a bad dream, always having a shoulder to cry on. Bella and I were inseparable, joined at the hip. That was until we moved. And her life went perfect while mine fell into the gutter. Thanks, sis. - The chapters may skip a lot at first in order to get the story going, and to fit the history of twilight into it, from Bella and her sister moving to everything in the books and after. Enjoy! Disclaimer// I do not own the twilight series or the characters within. They are Stephenie Meyers creations!! Twilight: 3 parts New Moon: 4 parts Eclipse: 4 parts Breaking Dawn: 4 parts After: 9 parts Reality: 8 parts New Dawn: 4 parts
Love of his life || J. H. Fanfic || by regs-swim-teacher
49 parts Complete
"They aren't just mates. They're soulmates." "Not only that, she's the love of his life." Read to find out ;) ❤︎︎❤︎︎❤︎︎❤︎︎❤︎︎❤︎︎❤︎︎❤︎︎❤︎︎❤︎︎❤︎︎❤︎︎❤︎︎❤︎︎❤︎︎❤︎︎❤︎︎❤︎︎❤︎︎❤︎︎❤︎︎❤︎︎ ︎ fair warning, this is the first story I ever wrote so it's kinda bad 💀 Other disclaimers: Obviously I don't own the twilight saga I can't write descriptions, just read to find out. Not edited. Twilight - breaking dawn both parts Twilight: done New Moon: done Eclipse: done Breaking dawn (both parts): done Started: 11/21/22 Finished: 1/29/24 (was on hiatus) Best ranks: #9 in the Cullens 5/22/23 #1 in Alaska 10/28/23 #2 in Bella Swan 11/8/23 #1 in Ophelia 5/26/24
The Witch's Imprint by ARSmedley
36 parts Complete Mature
You are the older adopted sister to Bella Swan and you recently found out you come from a long line of witches. While she lived with her mom in Phoenix and getting everything she wanted, you stayed with your dad in Forks working your tail off to get what you want. You know about the Cold Ones, Quileute Tribes and the treaty that was made between them. What happens when all of a sudden Bella decides that she wants to come live in Forks for awhile? What use to be an everyday routine, turns into helping the wolves keeping vampires out of La Push and keeping Bella from finding out about the Supernatural world. What happens when one of those wolves imprints on you? All Twilight Characters and related events belong to Stephanie Meyer. All Harry Potter characters and related events and characters belong to J. K. Rowling. All Teen Wolf characters and related events belong to a variety of people. WARNING!!!! SMUT IN THIS BOOK!! Begin: 1/21/2024 Finished: 2/12/2024 Edited: 7/02/2024
The Swan Sister by creativereader536
37 parts Complete Mature
What would happen if Bella had a twin sister? And what would happen when she moves to forks with her sister? How will she find her sisters boyfriend and will she like him? Maybe too much? Twilight I do not own any characters apart from those I choose to add. All credits for those go to Stephanie Meyer.
True Reflection || Twilight by roseking20
6 parts Ongoing Mature
𝐿𝒾𝓉𝓉𝓁𝑒 𝓁𝒶𝓂𝒷𝓈 ༒༒ Book 𝟙 ᴀ ᴘɪᴄᴛᴜʀᴇ ɪꜱ ᴀʟʟ ɪᴛ ᴛᴏᴏᴋ ꜰᴏʀ ᴇᴠᴇʀʏᴛʜɪɴɢ ᴀʀᴇʟʟᴀ ᴋɴᴇᴡ ᴛᴏ ꜱᴛᴀʀᴛ ᴇᴠᴀᴘᴏʀᴀᴛɪɴɢ ɪɴᴛᴏ ᴛʜᴇ ᴀɪʀ ᴀɴᴅ ʙᴇ ʀᴇᴘʟᴀᴄᴇᴅ ᴡɪᴛʜ ᴀ ɴᴇᴡ ꜰᴀʟꜱᴇ ꜱᴇɴꜱᴇ ᴏꜰ ᴡʜᴀᴛ ʙᴇᴄᴀᴍᴇ ʜᴇʀ ʀᴇᴀʟɪᴛʏ. ᴛʜᴇɪʀ ʀᴇᴀʟɪᴛʏ. [Twilight x OC] [ⒸRoseking20] Disclaimer: I do not own any Twilight characters that are featured in this book. Nor do I own any of the gifs or photos used. I only own my OC's and their plots.
Opposite. | Edward Cullen by PatheticFckinfool
10 parts Complete Mature
The relationship between me and my mother was always strained due to her habit of lying to us on numerous occasions. As a result, I found myself preferring my father over her throughout my life. However, my twin sister Bella seemed to turn a blind eye to my mother's behavior and preferred her over our father. Though I liked staying with my dad more because Renee, my mother, didn't like taking responsibility, Bella always insisted that we stick together as twins, even though we were complete opposites. So when I got the opportunity to be different from her, I took it. That chance came in the form of Edward and immortality. (NOT COMPLETE) {WARNING THIS STORY MAY CONTAIN GRAPHIC/MATURE CONTENT, IF YOU ARE SENSITIVE TO ANYTHING SKIP THE CHAPTERS WITH WARNINGS MAY CONTAIN - SEX - SUICIDE - MURDER - DIFFERENT TYPES OF KINKS [MAYBE] - AND OTHER MATURE CONTENT OF THE SORTS.}
The Purest of Cullen's by KolMikaelson63
111 parts Complete
She's got the eyes of innocence, The face of an angel, A personality of a dreamer And a smile that hides more pain, Than you can ever imagine. #1 bellacullen (28/10/18) #1 bellaswan (17/04/20) #1 alicecullen (20/01/19) #1 rosaliehale (02/09/19) #1 thetwilightsaga (16/02/19) #1 stephaniemeyer (23/02/19) #1 esmecullen (02/04/19) #1 jasperwhitlock (05/09/19) #1 hale (18/10/19) #1 renesmee (24/11/19) #1 volturi (18/10/23) #2 sethclearwater (07/05/19) #3 cullen (20/04/19) #5 edwardcullen (25/10/18) #5 jacobblack (22/08/19) OC x Unknown Started | 17/09/18 | Ended | 04/09/19 | Editing | 12/10/23 | - | 17/10/23 | Pre Twilight / Twilight / New Moon / Eclipse / Breaking Dawn 1 & 2 / Post Breaking Dawn
Learning love >Jasper Hale< by counterfeitX
23 parts Complete
the run away didn't go looking for love. lower case intended. [book one] *i do not own any of twilight. just my characters and their thoughts*
You may also like
Slide 1 of 10
Monster (Twilight X Reader) cover
Her Humanity cover
tough | b.swan cover
Love of his life || J. H. Fanfic || cover
The Witch's Imprint cover
The Swan Sister cover
True Reflection || Twilight cover
Opposite. | Edward Cullen cover
The Purest of Cullen's cover
Learning love >Jasper Hale< cover

Monster (Twilight X Reader)

22 parts Complete

After a night (Y/N) (L/N) was attacked by a monster of some sort, things were never going to be the same. In order to gain control of herself, she must pretend it didn't happen and lie when she asks her cousin, Bella, for help. So she leaves from New York City to Forks, Washington only to meet people that may be more of use than harm. When she gets stuck in the world of immortals and wolves, she learns more about what she's capable of, and how she can prevent others from harming those she loves. Note: This is a Jasper x Reader x Jacob, but I put it under Twilight x Reader. Update: THIS SERIES IS DISCONTINUED. I'm so sorry I always wanted to get back to this but I kept procrastinating until I eventually forgot. this first book is complete and there's parts of the second but no satisfying ending. Don't read if you don't want to be disappointed :(

More details