Story cover for Dark Getaway by taliej28
Dark Getaway
taliej28
  • WpView
    Membaca 4,623
  • WpVote
    Vote 167
  • WpPart
    Bab 5
  • WpHistory
    Durasi 54m
  • WpView
    Membaca 4,623
  • WpVote
    Vote 167
  • WpPart
    Bab 5
  • WpHistory
    Durasi 54m
taliej28
Lengkap, Awal publikasi Feb 23, 2015
beachdarkdarkangelsemmavleechfaefaeryfantasyholidayladameblancheprinceromanceshortstory
After a brief interview with The Crown Prince Of Alfeim. I did nothing else but dream away my days with fantasies of being whisked away by Corin to far away destinations but that is all they were...fantasies, until one day he blew me away with the craziest of notions. This is one adventure neither one of us will forget.

This is a fanfiction for the Series created by @LaDameBlanche. Corin is her character and belongs solely to her (disappointing i know)
Seluruh Hak Cipta Dilindungi Undang-Undang
beachdarkdarkangelsemmavleechfaefaeryfantasyholidayladameblancheprinceromanceshortstory
Daftar isi

5 bab

Daftar untuk menambahkan Dark Getaway ke perpustakaan kamu dan menerima pembaruan
atau
#235darkangels
Panduan Muatan
anda mungkin juga menyukai
Going Mad || OUAT - Once Upon a Time || Jefferson oleh abbeyberning
12 bab Lengkap
Elle has never felt a sense of belonging anywhere. So one day she, along with her friend Simon head out onto the road with nowhere in mind, hoping to escape their monotonous daily lives. By chance, they end up stopping in the cleverly named town of Storybrooke, Maine. But when she gets there, Elle discovers that she plays a much bigger role in this new town than she could have ever realized. In the midst of love, confusion and heartbreak, she must find out who she really is... if she wants to finally belong.
The Bane of the Empire oleh AnnyVirdi
41 bab Lengkap
The world is ruled by a tyrant King. The Old King was killed and with him the magic that coursed through the world was sealed away. Dawn Rentradie, a human girl, is sent to Eastmaw to collect a tome that triggers a sequence of events that places her in the path of a Fae warrior named Hunter. Follow Dawn, as she uncovers the secrets of a world just out of reach but all around her. Turns out magic wasn't just a children's story. Genre: Young adult, High Fantasy, Adventure, Romance, Fae Folklore
Beyond the Veil of Yonder (Book 1) oleh XannaLurel
101 bab Lengkap Dewasa
If you love the epic worldbuilding of 𝘓𝘖𝘛𝘙, the dark intrigue of 𝘎𝘢𝘮𝘦 𝘰𝘧 𝘛𝘩𝘳𝘰𝘯𝘦𝘴, the monster-hunting grit of 𝘛𝘩𝘦 𝘞𝘪𝘵𝘤𝘩𝘦𝘳, and the soul-deep romance of 𝘖𝘶𝘵𝘭𝘢𝘯𝘥𝘦𝘳, then this story is for you. --------------------------------- He's a battle-hardened knight; she's from the modern world. He survived horrors; she was shielded from them. His body and soul bear scars, but she still believes in wonders. He seeks redemption and peace, and she craves true love. Forgotten forests, cursed kingdoms, and a bond neither of them chose. Together, they must face ancient evils, unravel lost magic, and survive enemies in both shadow and light. Discover if love can truly banish the darkness in this thrilling, emotional tale! ⚔︎⚔︎⚔︎⚔︎⚔︎⚔︎⚔︎⚔︎⚔︎ "Omg... I've never been so invested in a story!" "The story is so captivating and engaging that I couldn't put it down." "The characters are incredibly well-developed!" "It reminds me of Tolkien's lost kingdoms and the mysterious allure of Arthurian and Celtic legends." *********************** 🏆 The Cliffhanger Queen by The Hidden Gem Awards 2024 ************************ 💎 FEATURED ON: @WackyWriters - "Our Judges' Favorites" @Romance - "Slow Burn" and "The Para-Romantasy Experience" @Fantasy - "Dark Fantasy" and "Serialized Spotlight" @highfantasy - "Fair Verona - Romantic Fantasy" @Ambassadors - "Para-Romantasy" @DaturaCommunity - "The Lavender | Fantasy" *********************** Highest Rankings: 🌟 #1 in Medieval Fantasy - 14/03/2025 🌟 #2 in Portal Fantasy - 05/11/2024 🌟 #2 in Gothic - 09/12/2025 🌟 #3 in Medieval - 02/12/2024 🌟 #4 in High Fantasy - 05/08/2024
The Shadow's Star oleh Llouisewrites
25 bab Lengkap Dewasa
18+ Loosely based on Romeo and Juliet set in a magical fae world. Two powerful families have ruled over the the dark and light fae for thousands of years. A story passed down from the old gods has them believe that the dark and light fae must remain separated in order to protect their magic. Only during the eclipse one day a year are the fae permitted to cross into each other's realms. During the eclipse Aurora a rebellious high born fae, secretly attends a masked party where she meets a handsome dark stranger called Azra. Will they bring the light and dark fae together to fight a common enemy? Are they fated to destroy the world or to save it?? Includes- an enemies-to-lovers story: a strong female lead, a handsome male counterpart, betrayal, heartbreak, lots of unexpected twists, epic ending, action packed, and plenty of smut. 18+ ONLY Trigger warnings!: adult language, graphic violence, scenes of a sexual nature, abuse. (Started August 2021) All rights reserved.
A Clash Of Light And Thunder (War Of The Forgotten Lovers Book 1) oleh AzulMidnight
43 bab Lengkap Dewasa
Featured in Wattpad HighFantasy & Magic II 19-year-old Aria is ready to accept her doomed fate of marrying the cruel Lord Lathik. An alliance that will secure a large army for her hateful brother's war against the fae. When destiny intervenes and her carriage gets attacked by bandits, she falls into fae territory. Pulled from the grasp of death and captured by the handsome crown prince, she can only pray he will never find out she is the enemy kingdom's princess. The fae prince, Elvin, is haunted by his mother's final words of a great war to come, of lies told, and a girl with redwood hair at the center of it all. When he saves a human that fits that description with rare light magic powers, he must decipher if she will be a friend or a foe. Is there something more to the lingering pull they feel towards each other? Will years of hate between humans and fae win out? How are their fates intertwined by the past? -----.------- "Do you know what you are asking?" Elvin's baritone voice vibrated down Aria's back. His velvet tone trickled down her skin like a gentle touch. "Yes... I want to know. What it feels like to be held with care." Aria truly did want to know... this may be the only chance she would get. ------.------ War Of The Forgotten Lovers Book 1 Best Rankings: #1 out of 6.5k in Fae 09/07/21 #1 out of 14.3k in Elf 10/02/21 #1 out of 18.7 in FantasyAdventure 10/01/21 #8 out of 87.9K in YoungAdult 09/13/21 EDITING
Beneath the Black Crown oleh Bizarekitty28
61 bab Bersambung
Love was never my choice. Survival is. He was meant to kill her. Instead, he crowned her. When Elara's boyfriend offers her as a sacrifice to the shadowed ruler of the Black Crown, she expects death. Instead, she's pulled into a realm of moonlit palaces and starlit rivers-where the king who should have been her executioner begins to look at her as if she belongs beside him. Now Elara must choose: return to the world that betrayed her... or take her place beneath the Black Crown.
On Stranger Tides oleh LittleMiss_Dauntless
30 bab Lengkap
°•A Captain Swan Fanfiction/Alternate Universe/Short Story•° Princess Emma was born and raised in the Enchanted Forest. She has been taught to be a hero since the day she could walk. Young Emma was waiting for adventure but there was something standing in her way. On her 18th birthday, she hears two kitchen maids talking about a secret that her parents have been keeping from her for a very long time. Emma herself holds a secret, that not even her parents know. Managing to break free and make her own decisions, she runs into the quite charming Captain Hook. One deal could change her life, forever. Emma faces the mistakes of her past, the cunning Peter Pan, her parents, her feelings for Captain Hook, and an unexpected villain stands in the way of her future, once more. -COMPLETE- {HIGHEST RANKING: #2 IN CAPTAINSWAN}
Seeing The Best... (A CaptainSwan Story) oleh arielinarial
29 bab Lengkap
A CaptainSwan fan fiction Takes place after the season 4 finale When Emma sacrifices herself for Regina's happiness she becomes the Dark One. Can her love for Killian save her from the darkness? Will our heroes find Merlin, and defeat the darkness for good? (All characters go to ABC, all plot before/during 4x22 goes to ABC, all plot after 4x22 goes to me) Ships in this story: CaptainSwan, OutlawQueen, Snowing, Rumbelle ...~COMPLETED~... Ranked: #8 in darkswan
Pirates of the Caribbean: Scales of Avón oleh M-B312
11 bab Lengkap Dewasa
Book 02/06 of the Archer Wyvern Series Infamous pirate Archer Wyvern separates from her friends aboard the Black Pearl for some much needed rest after the fiasco that transpired at Isla de Muerta. But when Wyvern is forced to help the British Royal Navy find Captain Jack Sparrow or she will be forced to return to her neglectful home, her life spirals into chaos. And with a full moon just on the horizon with the Curse of Omar Gyre still in play, what will happen? I only own this story and my oc's and original places/concepts. All rights to their respective owners. Pirates of the Caribbean © Disney Archer Wyvern/Leon Avón © Me Mia Avón © Me Winston Avón © Me Margaret Avón © Me Mark Azai © Me Olivia Azai © Me Ian Azai © Me William Azai © Me The Avenger © Me Commodore Ernest Virgil © Me Omar Gyre © Me Maelstrom Archipelago © Me Started: 10/05/2020 Finished: 23/05/2020 Fully Revised and Edited: ❌ By: Leon Sparrow
anda mungkin juga menyukai
Slide 1 of 9
Going Mad || OUAT - Once Upon a Time || Jefferson cover
The Bane of the Empire cover
Beyond the Veil of Yonder (Book 1) cover
The Shadow's Star cover
A Clash Of Light And Thunder (War Of The Forgotten Lovers Book 1) cover
Beneath the Black Crown cover
On Stranger Tides cover
Seeing The Best... (A CaptainSwan Story) cover
Pirates of the Caribbean: Scales of Avón cover

Going Mad || OUAT - Once Upon a Time || Jefferson

12 bab Lengkap

Elle has never felt a sense of belonging anywhere. So one day she, along with her friend Simon head out onto the road with nowhere in mind, hoping to escape their monotonous daily lives. By chance, they end up stopping in the cleverly named town of Storybrooke, Maine. But when she gets there, Elle discovers that she plays a much bigger role in this new town than she could have ever realized. In the midst of love, confusion and heartbreak, she must find out who she really is... if she wants to finally belong.

Detail lengkap