Walang Forever: Ang Libro ng mga Bitter
evanbelievable
  • Reads 79,747
  • Votes 2,365
  • Parts 143
  • Reads 79,747
  • Votes 2,365
  • Parts 143
evanbelievable
Complete, First published Feb 27, 2015
2016bittereditedhugothumorlovemartyrnafallpaasapafalltangaumaasa
Ang libro para sa lahat, lalo na sa mga BITTER. Mga mapapait ang buhay pag-ibig.

Pag-usapan natin kung bakit tayo nagiging bitter at kung bakit binasa mo ito ay dahil isa ka rin sa mga bitter o isa sa mga interesadong malaman kung paano nga ba maging bitter. 

Walang masama maging bitter wag lang natin gawing pang forever.

Read at your own risk. Bato-bato sa langit, tamaan hindi kasi umilag kaya 'wag magagalit. Talo ang mga pikon at bitter kapag tinamaan ka ng mga mababasa mo. 

Pag-uusapan din natin ang iba't ibang uri ng pag-ibig at ang mga nayayari ng lintik na pag-ibig na yan.

Simulan na ang pagiging bitter!
Public Domain
2016bittereditedhugothumorlovemartyrnafallpaasapafalltangaumaasa
Table of contents

143 parts

Sign up to add Walang Forever: Ang Libro ng mga Bitter to your library and receive updates
or
#533hugot
Content Guidelines
You may also like
I Fell and She Fell Harder [INTERSEX] by jyuuutko
34 parts Complete
Dahil lang sa pakikinig ng usapan, naituro siya bilang ama nang dinadala ni Aviah Alvarez na anak ng gobernador. Alam naman niyang kakaiba siya dahil mayroon siya katulad sa mga lalaki kahit na babae siya kaso never pa niya ito naipasok sa kahit sino! Halina't samahan natin ang ating bida na si Agisi Kith Salustio de Nicolo sa kaniyang kwentong I Fell and She Fell Harder! written and story by:jyuuutko
My Husband is a Mafia Boss (Season 2) by Yanalovesyouu
50 parts Complete
Marriage is normally one's happily ever after in the movies, but for Aemie Ferrer-Roswell, it's just the start of a seemingly unending adventure. Can this sweet Barbie-loving airhead continue to survive the life of being wife to a Mafia boss? *** Many things changed after Aemie Ferrer became Ezekiel Roswell's wife. With the might of Yaji and Roswells combined, things should have become smooth sailing for Baby Ae and her Dong--or at least, that's what everyone thought. But with lies, secrets and betrayals constantly plaguing the two, no one knows who to trust. This time, the silly and ditzy Aemie must step up to protect everyone and everything she cherishes--including the man she loves. Will they win and overcome this battle again? Or is it the perfect time for them to accept that Mafia stories have no happy endings? DISCLAIMER: This story is in Taglish COVER DESIGNER: Rayne Mariano
The Badass Babysitter Vol.1 ✓ by Nayakhicoshi
72 parts Complete
[THE BADASS BABYSITTER] Para sa isang Presidente ng bansa, malaki ang expectation nito sa mga anak niya. You should be the best for him to be proud of you. Pero iba ang expectation ng Ama ni South sa kanyang anak. Para sakanya, wala siyang aasahan sa anak. Well, ano ba naman kasi ang aasahan mo sa isang basagulera at laging laman ng balita sa diyaryo? Southern Miracle Benedicto is your typical badass girl. Basagulera. Makapal ang mukha. Matapang-at walang pera. Her father cut all of her cards making her the "poorest-richest" woman in the world. Para sakanyang ama, wala siyang kwenta. Sinisira lamang nito ang pangalan sa lipunan kaya bago pa masira nang tuluyan ni South ang image ng Pangulo, he decided to send his daughter to a place where she no longer put his name on a shame again. Malakas ang loob ni South na tanggapin ang parusa pero akala niya ganoon kadali na ipatapon sa lugar na hindi niya inaakala. She expected something luxurious, a freedom-sabi nga sa kasabihan, expect the unexpected. Crane Brothers. Mga magkakapatid na kinulang sa turnilyo ang utak. Kinulang sa buwan nang sila'y ipinanganak. Paano kung ang role pala niya ay ang i-babysit ang mga ito? Makakaya ba niya? Pero ang malaking tanong.. Matatagalan ba niya ang mga tokmol na magkakapatid? O, Maging kriminal na siya sa sobrang bwisit sakanila?
Island Trap (Book 1 of Trap Trilogy) by VentreCanard
34 parts Complete
What Sidra Everleigh wants, Sidra Everleigh gets-or at least that was the rule before she found herself trapped and alone with a shy Japanese guy in an isolated island with nothing but a dusty tent, some tuna cans, and their huge language barrier. *** After a cruise ship incident, the gorgeous yet infamous actress Sidra Everleigh Rosilla finds herself alive but trapped in an island with a shy Japanese guy as her only companion. To ease her loneliness, she humors herself with flirty antics and humorous dramatic lines that seem too much for the poor inexperienced guy. But what happens when her mission to purely flirt and have fun gets a little bit deeper with him-and it's not just her imagination? Will she be able to break their language barrier or will she get kureiji before their rescue comes? DISCLAIMER: This story is written in Taglish (with a little bit of Nihonggo) COVER DESIGN: Rayne Mariano
A Hundred Billion Worth by reintold
60 parts Complete
WARNING: This story is my oldest story! You might encounter some cringe and immature scenes that needs some revisions! ... He bought me, but I didn't know that I was more than a hundred billion worth.
Good night, Enemy (Published under PSICOM) by Serialsleeper
75 parts Complete
(FHS#1) Braylee wants to make her friends happy, Denver wants to get some sleep. She's hell-bent on making the world a better place while he's desperate for some rest. When their paths crossed on a midnight bus ride, he finally found the remedy in her. But, it just so happens that he's the captain of their rival basketball team, and the enemy of her friends! Highest Rank: #1 in Humor (This is the unedited version. A cesspool of errors ahead lol)
Chasing Hurricane by Serialsleeper
32 parts Complete
Hanapan ng girlpren si bitter bestfriend na friendzoned since birth? Game!
JB1: The Cold Hearted Father [BXB] [√] by biisool
57 parts Complete
Juariz Bachelors #1 [BXB] [MPREG] STATUS: COMPLETED Si Austine Villaluz ay isang fresh graduate sa kursong general education. He loves kids and would certainly do everything to have one as his own ngunit ang problema eh hindi niya kayang kumain ng tahong. Sa puso niya isa siyang reyna ng mga unicorn at mamatay sa ngalan ng bahaghari. Sa di inaasahang pangyayari siya ay naging instant mommy sa isang kyut na chikiting na nasagip niya mula sa mga goons na humahabol dito. Makakaya kaya niyang maging motherhood sa isang bulilit? Paano kong isang araw kumatok sa pinto niya ang ubod ng gwapong lawyer at magpakilala bilang tatay ng bata? Makakaya kaya nilang malayo sa isa't-isa? Book cover made by: @IThinkJaimenlove/ Jaime Kawit
23:11 by pilosopotasya
115 parts Complete
A writer. A weird stranger. A lot of little conversations. An online understanding. Every night. 23:11.
You may also like
Slide 1 of 9
I Fell and She Fell Harder [INTERSEX] cover
My Husband is a Mafia Boss (Season 2) cover
The Badass Babysitter Vol.1 ✓ cover
Island Trap (Book 1 of Trap Trilogy) cover
A Hundred Billion Worth cover
Good night, Enemy (Published under PSICOM) cover
Chasing Hurricane cover
JB1: The Cold Hearted Father [BXB] [√] cover
23:11 cover

I Fell and She Fell Harder [INTERSEX]

34 parts Complete

Dahil lang sa pakikinig ng usapan, naituro siya bilang ama nang dinadala ni Aviah Alvarez na anak ng gobernador. Alam naman niyang kakaiba siya dahil mayroon siya katulad sa mga lalaki kahit na babae siya kaso never pa niya ito naipasok sa kahit sino! Halina't samahan natin ang ating bida na si Agisi Kith Salustio de Nicolo sa kaniyang kwentong I Fell and She Fell Harder! written and story by:jyuuutko

More details