Story cover for Crayon lovers by Marysprouse11
Crayon lovers
Marysprouse11
  • WpView
    Leituras 17
  • WpVote
    Votos 0
  • WpPart
    Capítulos 6
  • WpHistory
    Tempo 16m
  • WpView
    Leituras 17
  • WpVote
    Votos 0
  • WpPart
    Capítulos 6
  • WpHistory
    Tempo 16m
Marysprouse11
Em andamento, Primeira publicação em mar 28, 2023
californiaceocompetitionenemyfightforlovefightforsurvivalfyplovemenmilitaryperfectlyimperfectrichsoldiertwomenonegirlusa
Breanna Collins is a rich girl from California with a "perfect" life and family. After a traumatic situation last summer, she decides to join the Marines to be a nurse. 
Family is not supporting in the first sight and she starts a new life, far away.
Like many people she gets deployed and meets a high ranking marine with a complete different life.
Deployment hits hard and she comes closer to him and other marines.
They have to survive. People die, people love.
How is it going with the hot Marine?            
Or how is it going with the rich CEO?
Who is she going to pick?
Are they going to fight? Definitely! 


Still in the making! 
I hope you enjoy it, trust me the fire's still coming ;)
Todos os Direitos Reservados
californiaceocompetitionenemyfightforlovefightforsurvivalfyplovemenmilitaryperfectlyimperfectrichsoldiertwomenonegirlusa
Índice

6 capítulos

Inscreva-se para adicionar Crayon lovers à sua biblioteca e receber atualizações
ou
#382perfectlyimperfect
Diretrizes de Conteúdo
Talvez você também goste
UNCONDITIONALLY YOURS, de Rae_ans_
57 capítulos Concluída
(COMPLETED) He's everything she hates. A rich, arrogant, cocky playboy. She should be repulsed by him, but from the first moment she met him face to face, her heart of ice ineluctably set on fire. He had one mission. Something he had struggled for his entire life. Something that he was so determined to do, he once believed there nothing that could stand in his way. He should have known better. Nothing that you long desperately enough for comes without a price. But what price do you have to pay when you start to spend a little too much time around the one you were born to despise. ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ "I don't have anything to bribe you with, only my own words. Tell me, how will you ever be free if you do not take a risk every once in a while?" "I take risks." "You may take risks that give you freedom from your life, but I have a feeling this risk is a little different on many levels, correct me if I'm wrong." I began to think, did one single day really matter? Maybe it would help, maybe it was all I needed to stop thinking about him. "Make the most of it as it will both the first and the last time you are taking me to lunch, let alone ever seeing me again."
Taming the billionaire, de Romeo1fer
56 capítulos Concluída Maduro
Helen Druman a simple girl with simple dreams,strong willed, hardworking and a fiery personality owns a small restaurant in one of the busiest places in New York one of the most beautiful girl in her family who wants to achieve something on her own her family doesn't support her and hence the consider her as a black sheep of their family she's never treated well her sister is one of the supermodels right now and her family loves her to the core and keep on neglecting Helen who has a golden heart. Roger Montford The owner and CEO of the Montford internationals the most handsome and eligible blue eyed bachelor and soon to be leader of one of the most powerful mafia and influential families in the country he is strong willed, hot headed and arrogant guy who takes no shit from others and has a care a damn attitude soon destined to meet his match in the form of a fiery lioness. Charles Davidson A charming, handsome and rich green eyed bachelor who currently is at the number one spot with Roger best friends and business partners the CEO of Davidson Inc. knows how to rule and win a woman's heart and he shares a past with the fiery beauty
His Baby, de AlexandriaRoseWalker
35 capítulos Concluída Maduro
A/N - There are many spelling and grammar mistakes - I apologise, also this was written when I was a teen so this story is so beyond reality. Thanks. Rose Quinten is the daughter of an ex-Navy seal turned security for the rich and famous. After a tragic life in England they up and move to sunny California where she meets the bad boy at a party when a guy tried to force himself on her he saves her, keeping her safe in a room they play games all night then things get heated. Rose unknowingly meets the family of the guy she slept with. Rose is in for one hell of an adventure and also gets more than she bargained for in the end. Comments - "I have to say this is a sweet romance that brings the wonders of being a new mom (dad) in to it, Its a romance that id read again (I've already read it a couple of times XD) I love how she (rose) is not like everyone else I've read. Its refreshing, I mean she's strong, hard-headed (at times) And witty. Its funny reading about how she boss's everyone around (in a good way of course) the Adventures. The tell of a girl turning in to the women she is to day. Its breath taking, I'm gonna stop now before I say to much, But its a good book that can make you laugh just as fast as it can make you cry.... Ok for real I'm stopping (lol) But its a wonderful read" - arrow1616 #5 in Teen Fiction out of 243k Stories - 03 Oct 2020 #3 in Teen Fiction out of 254k Stories - 25 Apr 2022 © This book is of my own creation and I reserve all rights to it. Pictures used in this book are Public Domain.
The Dangerous Ones [✔️] (#1 in the Chilvati Series), de DELynch43
68 capítulos Concluída Maduro
[COMPLETED, 18+) ''Let's get one thing straight.'' His tone was as stern as his grip. ''We don't make idle threats. No need to.'' The harsh stare slid down to her mouth. ''We take what we want.'' In the deteriorating Southeast district of Los Angeles, police struggle to control the ongoing success of a notorious crime family. One cop stands out among the rest, her integrity the defining line between law and corruption. But when passions flare, lines are often crossed . . . Lieutenant Virginia Robins has been waging war on organized crime for nearly ten years, hell-bent on shutting the Chilvati family down, one arrest at a time if necessary. Now the fight turns personal after her partner is killed in a suspicious fire and rumors spread about his possible link to the family. No longer willing to play by the rules, Virginia sets her sights on the man she believes is responsible, a man most people respectfully fear. Consumed by the need to clear her partner's name, solving his case is all she cares about--until the day her daughter is taken. Mark Spinelli is well-known for his quick temper and womanizing ways, although the true fame comes with the ruthless occupation. As underboss of the powerful Chilvati family, he trusts no one outside of the few loyal men sworn to protect him. Still, he can't help but admire the determination of the irate beauty who insists on sticking her investigative nose where it doesn't belong. And on the day she needs a hero, Mark shocks everybody, including himself, when he becomes one. Virginia finds herself captivated by the mysterious, intimidating man who won't talk about his past, and she puts her heart, career, and life at risk when she takes that next step, into his arms, into his dark world. WARNING: This story contains strong language, sexual content, and some mild violence. 2018 ABBA (Annual Bad Boy Awards) Winner Featured story on: @Romance @Dangerouslove @Action @Adultfiction @Crime @ProjectBadassGirls @ProjectBadBoys
Mil SO (Military Significant Other), de CaylahWest
39 capítulos Concluída
My chest hurt as an empty feeling rushed over me. My breathing picked up as I clutched my chest. It was painful but yet, oh so familiar. Black dots swam in my vision as my heart beat wildly. I closed my eyes and tried to calm my breathing. Panic attacks weren't uncommon for me. I'd had them ever since the accident. I felt the tears roll down my cheeks as my face heated. It was getting harder to breath. It felt like the walls were closing in around me, and the oxygen was being sucked out of the room. "Iris! Calm down. You have to calm down," a voice sounded from a distance. It was too late; I was in full panic attack mode. My body shook as I sobbed in gasps. I felt hands on my arms but barely. I was too far-gone. The black dots increased as my breathing did. I'd done this too many times to know what was coming next. I hyperventilated until I passed out completely. ~ After a traumatic event that led to her family's death, Iris moves with her Aunt to California to try and start over. Iris Morgan grew up a military brat. With her dad in the Marines, she grew accustomed to that lifestyle, until she was ripped from it. Now she has to be the new girl all over again. Only this time, she has to keep her PTSD in check as well as survive a high school full of teen celebrites, cute boys, and around the clock drama. All Iris has to do is survive two years until graduation, but what comes after graduation may prove to be more difficult than high school itself.
THE QUEEN OF MY HEART, de KiaraK007
29 capítulos Em andamento
A Love Battle Between Two Royals #enemies to lovers or just #enemies to enemies -Read the introduction to understand completely and clearly- Where Avyanna is pure and dangerous both, just like an active volcano. Who can explode once it reaches to limit. And Vincent, who is a Playboy but can be serious when it's come to his responsibility. He can burn anyone with his anger. What will happen when both fire will bumped with eachother? How will their love bloom? In a full of hatred relationship? Can we even call it relationship? When they both are enemies at the first sight? . . . . Let's witness their enemies to lovers relationship together 🤗
Undeniably Wanted, de KaylaWoods289
74 capítulos Concluída Maduro
Heather Drake is a 22 year old who is hiding from her past and trying to start a new life in California. She is going to be starting with a new career as a teacher at a private school. She is beautiful & witty and doesn't stand for bullshit. Who wouldn't notice her?.. What happens though when she catches the eye of someone who doesn't want to let her go... Who is attached at first sight and wants nothing else but her. Xavier Sanford is a 25 year old billionaire CEO who is also a single father. He also is a very dangerous man if need be and takes what he wants. He doesn't believe in relationships since they all disappear in the end however all it took was one glance at a bombshell beauty and he knew... she was HIS. Preview: "You will be mine Miss Drake and I do not share." I state sternly. "Release my arm Mr. Sanford before I force you to." She states giving me a fake smile. I smirk at her. She takes her other hand and squeezes my wrist before twisting it in a painful position. I hiss in pain. "Don't underestimate me Mr. Sanford." She whispers in my ear before gently pushing me away from her. I shake my hand and look back at her. "This is the only time I will allow you to walk away from me Miss Drake." She turns and glares at me. "Mr. Sanford, I am no possession of yours. " She pushes the classroom door open and leaves me standing there.
When the Tables Turn, de SheLovesAGoodStory_
25 capítulos Concluída
💕💕💕 Thank you all so much for your incredible support! Unfortunately, it has come to my attention that someone is plagiarizing my stories and posting them on other apps. If you come across any of these instances, please report them immediately. I want to clarify that I would never charge for these stories-they are something I genuinely enjoy sharing with you all for free 🫶🏾. Jalissa Madden gave up everything to support Ethan Smith's dreams-only for him to betray her in the worst way. Heartbroken but determined, she reinvents herself and rises stronger than ever. When fate brings Ethan back into her world, Jalissa sees her chance. This time, she's in control. When the Tables Turn is a gripping tale of betrayal, resilience, and the ultimate revenge: success.
His Tamed Heart, de Kadenereadaholic
34 capítulos Concluída Maduro
This story is the sequel to 'Her Saving Grace'. In order to understand fully and not be confused, please read 'Her Saving Grace' first. ****** Kayla Green is now at university studying medical science. Carson Knight is at a different university in the same state studying to become an engineer. All their dreams are coming through and everything is working out for them... Or is it? Carson's new found happiness is threatened when his enemy catches up with him...and he only wants one thing; revenge. Carson also has other things to worry about as there is a new boy in the picture and he has his eyes on his girl. Join Carson and Kayla on their journey of love, fight, betrayal, jealousy, heartbreak and forgiveness. WARNING: This story contains graphic depiction of violence. °°°°°°°°°°°° Amazing cover made by @DiamondSkys
Trapped In Love ✓ , de StellaAdamsHere
49 capítulos Concluída
"C- Can you move b- back a little?" My words made him smirk and if it's even possible, he came closer. Why do I always have to stuck between him and the desk?! "Why? Am I making you nervous?" "No." I lied. Ofcourse, he was making me nervous. His eyes had the power to hold a person on his place and that's what his eyes were doing to me. "Really?" He asked, putting his hands on my waist and pulling me closer towards him. On instinct, I put my hands on his chest. I didn't like it. I didn't like the way my body was responding to his touches. "T- This is un- unprofessional." I choked out the words, but I wish I couldn't have. He brought his face closer, so close that I could feel his minty breath on my lips. My lips parted accordingly in shock. "Oh, is it?" He said, mockingly. Oh god! What have I gotten myself into? •••• Aaron Steele, the CEO of the multi billionaire Steele's Company was the eligible bachelor of 25. He always had his way among girls and having blue eyes, a chiseled jaw and a hot body, didn't help either. With new woman on her arms every other day, he was obviously not planning on falling on that cliché word also called love, but would his thoughts of not falling in love still remain the same, after meeting her? Sienna Collins was a girl of 22 with extremely shy personality. After completing her graduation, the only thing in her mind was to get a good job and settle on her own, but what she didn't expected was a job at Steele's Company. This is a story of the innocent and the sinful. Read inside to find out what happens when two persons from exactly opposite worlds collide together. #I would suggest 14+ to read this story as some part in the book contains mature scenes. ~ # 37 in Romance #12 in humor *I am not a grammer nazzy, so there would be grammatical mistakes.*
Talvez você também goste
Slide 1 of 10
UNCONDITIONALLY YOURS cover
Taming the billionaire cover
His Baby cover
The Dangerous Ones [✔️] (#1 in the Chilvati Series) cover
Mil SO (Military Significant Other) cover
THE QUEEN OF MY HEART cover
Undeniably Wanted cover
When the Tables Turn cover
His Tamed Heart cover
Trapped In Love ✓ cover

UNCONDITIONALLY YOURS

57 capítulos Concluída

(COMPLETED) He's everything she hates. A rich, arrogant, cocky playboy. She should be repulsed by him, but from the first moment she met him face to face, her heart of ice ineluctably set on fire. He had one mission. Something he had struggled for his entire life. Something that he was so determined to do, he once believed there nothing that could stand in his way. He should have known better. Nothing that you long desperately enough for comes without a price. But what price do you have to pay when you start to spend a little too much time around the one you were born to despise. ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ "I don't have anything to bribe you with, only my own words. Tell me, how will you ever be free if you do not take a risk every once in a while?" "I take risks." "You may take risks that give you freedom from your life, but I have a feeling this risk is a little different on many levels, correct me if I'm wrong." I began to think, did one single day really matter? Maybe it would help, maybe it was all I needed to stop thinking about him. "Make the most of it as it will both the first and the last time you are taking me to lunch, let alone ever seeing me again."

Mais detalhes