Story cover for The Diary of Iris by JanineeFrancis
The Diary of Iris
JanineeFrancis
  • WpView
    Reads 12
  • WpVote
    Votes 0
  • WpPart
    Parts 3
  • WpHistory
    Time 8m
  • WpView
    Reads 12
  • WpVote
    Votes 0
  • WpPart
    Parts 3
  • WpHistory
    Time 8m
JanineeFrancis
Ongoing, First published May 05, 2023
Mature
adultbuildercountrycountrylovedaddarkpastdiaryfarmgardenhealirisloveloveagainmentalhealthnewromanceromanticsuspensesexysinglesingledadusawashingtonwilliamyoung
Iris McDell has always felt like an outsider in society. With her love of flowers, music, and baking, she prefers a quiet life that doesn't always fit with the expectations of those around her. When she moves to a small town in the Pacific North West at the age of 25, she hopes for a fresh start and a chance to finally fit in.

But soon after arriving, Iris meets a mysterious man who leaves her unsure whether she can trust him or not. Despite her reservations, Iris finds herself drawn to him and begins to uncover secrets about her new home and her own past.

As Iris delves deeper into the town's history and the man's true identity, she realizes that her peaceful new life may not be what it seems. With danger lurking around every corner, Iris must decide who she can trust and how far she is willing to go to uncover the truth and protect herself and those she loves.

Will Iris be able to unravel the mystery surrounding the town and the man who has captured her heart, or will her past continue to haunt her and threaten her newfound happiness? Only time will tell in this gripping tale of love, trust, and betrayal.
All Rights Reserved
adultbuildercountrycountrylovedaddarkpastdiaryfarmgardenhealirisloveloveagainmentalhealthnewromanceromanticsuspensesexysinglesingledadusawashingtonwilliamyoung
Table of contents

3 parts

Sign up to add The Diary of Iris to your library and receive updates
or
Content Guidelines
You may also like
Eve of Enlightenment by gustopholous
78 parts Complete
A mysterious past, an unrequited love, and a desperate need to find himself, fifteen-year-old Kalyn has enough to occupy him without being on the verge of a massive societal upheaval. Join Kalyn and his friends as they explore what it means to come into themselves. Romance, friendship, and the importance of unity: There's no denying Destiny... Reader praise: "The quality is top tier." -MiloPFitz "These words are pieces of gold." - SiberiatheWriter "A nice, easy-reading style, but still kinda poetic." -katotjjx "Heart-warming!" -MetalCanine "Evoking!" -CASZETTES "This story is so beautiful, words don't do it justice. One of those books that stays with you forever, makes you feel a million emotions, and you're thankful for every single one." -ScarletWren "The word flow is beautiful and on point!" -NicklesForADime "A unique and exceptionally good writing style! It's poetic without being difficult to read. I love it!" -Metalcanine "Nicely penned." -JanJacinto "Very beautiful and emotion-filled." -PritongManokens "Poetic and beautiful yet simple and easy to understand." -V_star_24 "Sweet, beautiful, and utterly heartbreaking." -WriterofStarlight Awards: 🥇Campfire Awards 🥈The Savant Awards 🥉 True Writing Contest 🥉Dream Awards 2022
Into the Sunshine: Of Love and Loss Series Book Two by BritCYancey
29 parts Complete
**** Picks up where Through the Darkness: Of Love and Loss Series Book One ends**** Is newfound love a threat to shattered hearts weighed down by the past? Or a beacon of hope for an uncertain future? Devastated by loss, young widow Iris Cooper moves to Malad, Idaho, a peaceful small town nestled in the Great Basin Mountains. There, she grapples with piecing together the fractured remnants of her life. When fate intervenes, she crosses paths with Everett Monterose, an enigmatic, handsome widower focused on caring for his newborn twins. Everett can't deny Iris's presence stirs emotions he believed dead and buried, feeling as if he's stepped out of his stormy, bleak existence and into a pool of warm sunshine. Amidst their shared grief, a spark of hope and yearning ignites, kindling a connection that transcends their pain. Though drawn to each other, they're cautious about risking their fragile hearts - until asking themselves if they'll allow this second chance at love and happiness to slip through their fingers.
Silver Lining by daisyclouds89
36 parts Complete Mature
When bad things happen there must come a silver lining because, without one, there is no moving forward, however, for Iris, it's not all so easy. On the night she got her eviction notice she meets a guy who will become a permanent part of her life moving forward, as well as an unplanned pregnancy. [Single dad, pregnancy, hockey, famous, forced proximity/roommates]
Dominion Falls by JulieRockwell2
22 parts Complete Mature
After her parents die unexpectedly, Sarah learns she has inherited an old farm that has been neglected for years. She is determined to make it a working farm again and restore it to its former glory, but will it end up being too much for her? or will she make her dreams come true against all odds.
Lost by newadvantures
19 parts Complete
'A 17 yr old girl's visit to a town which she does not quite like. A new neighbouring boy who sneaks into her backyard quite often. A friendship based on just conversations. How does this new thing go for both? How far can it go? Will life allow any progress?' Completed. ⚠⚠⚠⚠⚠⚠ THERE ARE MENTIONS AND DEATH OF CHARACTERS. ⚠⚠⚠⚠⚠⚠ MENTION OF SUICIDAL THOUGHTS ⚠⚠⚠⚠⚠⚠' Hey! This is Annie cuz y not... This is the first time I am writing so I really hope you appreciate my attempt. But more importantly I hope you enjoy the story. 😊 I won't be able to give regular updates but I will try to put up on a weekly basis (Saturday or Sunday) Hope you enjoy the read!! Thank you very much. ☺
His eyes of euphoria by thatweird_bitch
35 parts Complete
* TRIGGER WARNING* there may or may not be parts of this book that people may find upsetting. It talks about mental illness. Also it talks about religion so if any of these things may trigger you then I recommenced not reading this. However feel free to talk to me because I'm hear to support y'all. 16-year-old Matthew is on the lengthy journey of self-acceptance and discovery. How will he cope with a rising taste for a blonde boy who managed the earth on his fingertips like crushed berries. Will he learn to love himself? Or will he allow his doubt to control him and his sprouting relationship? "Taste me in crimson so that when we taste no more, when age will turn our buds sour and memories hazy, that I have hope to scour my letterbox and find you wrapped pristine silk, next to an image of June. Within your eyes, euphoric." Acknowledgements 1# slice of life 15/01/21 23# closeted 15/01/21
Chasing the Fantasy ||Completed by ElizabethPrempeh
21 parts Complete
★When reality is kept at bay ★When fantasy takes the domain ★It is an escape?! This is a world where politics, religion and love dance together; where deception takes several forms; and where betrayal is masked as friendship. Joe is captivated at once by gorgeous Nancy, a former babysitter turned musician and first lady. But his ambitions and desires throw him into an intricate race against time and crime. Just when he turns over a new leaf, a cruelly sinister plan is in motion to knock him to the curbs. Available on Amazon: https://www.amazon.com/dp/B097TNCW6D
Sanctuary of Shadows by Satin_moon70
21 parts Ongoing
When sixteen-year-old Iris reluctantly agrees to join her friends on a hike through the woods, she expects boredom, blisters, and maybe a few sarcastic quips to get her through the day. What she doesn't expect is to stumble upon a forgotten church in the middle of nowhere-a building untouched by time yet teeming with an inexplicable darkness. At first, the group is drawn in by curiosity, but the deeper they explore, the more unsettling the church becomes. Uneasy whispers, eerie smells, and strange visions plague Iris, leaving her questioning her sanity. But when her friends begin disappearing, taken by an unspeakable creature lurking in the shadows, it becomes clear this place is more than just haunted-it's alive. Trapped inside with no way out, tensions flare, secrets unravel, and fear morphs into paranoia. As the church's sinister grip tightens, Iris must confront her past encounters with the supernatural and rally the others-if they don't tear each other apart first. In a place where reality warps and survival is far from guaranteed, one question lingers: Can they escape the church before it consumes them all? Prepare for a chilling descent into madness, betrayal, and the unknown in this psychological horror that will haunt you long after the final page.
THE THREE QUEENS OF ESTRIA by LAIDYCC
8 parts Ongoing
"It's been 24 hours since my girlfriend of 5 years broke up with me and essentially fucked my entire life plan." When iris' long term girlfriend up and leaves her just before their anniversary, with nothing but questions and irrational behaviour she is left hurt and angry, hell bent on maintaining an unhealthy balance between heartbreak and obsessive vengeance. But when a huge business deal leads her to a secluded island, nothing could have ever prepared the ever chaotic Iris for the drama that comes with a polyamorous couple in the package of three married women. Follow Iris as she navigates her lingering love for her first love, and the new and irresistible allure of these women. One thing is certain, she will be damned if any of this brings down her awesomeness. * Fantasy, sapphic, romance in the house I hope you enjoy, I'm still very much a novice writer but I want to improve.
You may also like
Slide 1 of 9
Eve of Enlightenment cover
Into the Sunshine: Of Love and Loss Series Book Two cover
Silver Lining cover
Dominion Falls cover
Lost cover
His eyes of euphoria cover
Chasing the Fantasy ||Completed cover
Sanctuary of Shadows cover
THE THREE QUEENS OF ESTRIA cover

Eve of Enlightenment

78 parts Complete

A mysterious past, an unrequited love, and a desperate need to find himself, fifteen-year-old Kalyn has enough to occupy him without being on the verge of a massive societal upheaval. Join Kalyn and his friends as they explore what it means to come into themselves. Romance, friendship, and the importance of unity: There's no denying Destiny... Reader praise: "The quality is top tier." -MiloPFitz "These words are pieces of gold." - SiberiatheWriter "A nice, easy-reading style, but still kinda poetic." -katotjjx "Heart-warming!" -MetalCanine "Evoking!" -CASZETTES "This story is so beautiful, words don't do it justice. One of those books that stays with you forever, makes you feel a million emotions, and you're thankful for every single one." -ScarletWren "The word flow is beautiful and on point!" -NicklesForADime "A unique and exceptionally good writing style! It's poetic without being difficult to read. I love it!" -Metalcanine "Nicely penned." -JanJacinto "Very beautiful and emotion-filled." -PritongManokens "Poetic and beautiful yet simple and easy to understand." -V_star_24 "Sweet, beautiful, and utterly heartbreaking." -WriterofStarlight Awards: 🥇Campfire Awards 🥈The Savant Awards 🥉 True Writing Contest 🥉Dream Awards 2022

More details