silent 2098 (the last ninja)
FlameAkio
  • Reads 4
  • Votes 1
  • Parts 1
  • Time <5 mins
  • Reads 4
  • Votes 1
  • Parts 1
  • Time <5 mins
FlameAkio
Ongoing, First published Jun 11, 2023
adventureanimeassassincitiescitycomputercyperpunkdarkfightforlovefightforsurvivalhackerkillermafiamysteriousmysterynightnightterrorninadobrevninathekillerninjasamuraisuperherotokyo
In the year 2098, Tokyo had become a dystopian city, ruled by the secret mafia and criminals. Everyday citizens lived in constant fear, knowing that they could be targeted by these powerful entities at any moment. However, there was one man who was not afraid. His name was Akio, and he was a force to be reckoned with.

"Let the darkness within you be the hope for people"
Public Domain
adventureanimeassassincitiescitycomputercyperpunkdarkfightforlovefightforsurvivalhackerkillermafiamysteriousmysterynightnightterrorninadobrevninathekillerninjasamuraisuperherotokyo
Table of contents

1 part

Sign up to add silent 2098 (the last ninja) to your library and receive updates
or
#2cyperpunk
Content Guidelines
You may also like
Homelander: New Legacy by Dragon155913
157 parts Ongoing
When Roger, an ordinary man with an extraordinary heart, is suddenly reincarnated into the body of Homelander, the world's most powerful and controversial hero, he faces an unimaginable challenge. Now endowed with not only Homelander's immense abilities but also Superman's legendary powers, Roger is both shocked and overwhelmed. What will his future hold???
ငါလှည့်စားခဲ့တဲ့ဇာတ်လိုက်ပြန်မွေးဖွားလာပြီဟ || ဘာသာပြန် [ Book-2 ] by Boss_want_to_eat_you
132 parts Ongoing
Arc(9)-Arc(14)+Real World+Extra အာဏာရှင်ကုန်းvsနတ်ဘုရားရှို့
Tensura: The Abyss Demon by Wahabadebanjo
62 parts Complete
What if rimuru was instead reborn as a primordial demon the strongest in combat and intelligence. He reincarnated just before Star king dragon Veldanava created the omniverse; it was nothing but a void, his soul being exposed just a little to turn null made his soul undergo a change. Making him an individual with a high evolutionary potential
𝒯𝒽𝑒𝒾𝓇 𝓁𝑜𝓃𝑔 𝓁𝑜𝓈𝓉 𝓅𝓇𝒾𝓃𝒸𝑒𝓈𝓈 by lilliej1001
60 parts Ongoing
Olivia was taken from her family at the age of 2 by her families rivals. She can't remember anything before then, the only thing she can remember is living with her "mother" and step father. The Rivera's were mentally destroyed after her disappearance. Her father spent 14 years searching for her until his sudden death leaving the 6 brothers distraught. Olivia always thought she deserved a loving home, what will she do when her "parents" "pass" away due to their addiction? She finds out she has 6 older brothers, will they take her in? Will they find out she has some secrets of her own? What will she do? Read on to find out!!
The Flash: The Fastest Man Alive (Male Reader Insert) by Fredbot
76 parts Ongoing
Y/N L/N was always a believer in the impossible, but he never suspected he would become the impossible. When a fateful lightning strike gives Y/N the power to move at super fast speeds, he must learn to step up as a hero against similarly affected people, ones whose agendas pose a threat to the world. Finding a team to call family, Y/N learns the power of speed, responsibility, teamwork, and love. He is the fastest man alive. He is the Flash. The Flash and other properties are under the ownership of DC and Warner Bros. I did not intend on using this story for revenue or monetary gain. All rights reserved to their original owners.
ᴀᴜɢᴜsᴛ | ᴊᴊ ᴍᴀʏʙᴀɴᴋ by miguelschamp
75 parts Ongoing
"ᴛᴏ ʟɪᴠᴇ ꜰᴏʀ ᴛʜᴇ ʜᴏᴘᴇ ᴏꜰ ɪᴛ ᴀʟʟ. ᴄᴀɴᴄᴇʟ ᴘʟᴀɴs ᴊᴜsᴛ ɪɴᴄᴀsᴇ ʏᴏᴜ ᴄᴀʟʟ ᴀɴᴅ sᴀʏ "ᴍᴇᴇᴛ ᴍᴇ ʙᴇʜɪɴᴅ ᴛʜᴇ ᴍᴀʟʟ. sᴏ ᴍᴜᴄʜ ꜰᴏʀ sᴜᴍᴍᴇʀ ʟᴏᴠᴇ. sᴀʏɪɴɢ "ᴜs" ᴄᴀᴜsᴇ ʏᴏᴜ ᴡᴇʀᴇɴ'ᴛ ᴍɪɴᴇ ᴛᴏ ʟᴏsᴇ." [sᴇᴀsᴏɴ 1 - ???] ꜰᴇᴍ!ᴏᴄ x ᴊᴊ ᴍᴀʏʙᴀɴᴋ
The Lost De'Luca by SymplyNath
86 parts Ongoing
Amazing cover by Anel_Graphics Gabriella De'Luca is a cold fifteen year old girl, who has had to go through extreme hardships everyday of her life. Constantly being abused by her mother's boyfriend. He made her life a living hell yet she still loved her mother who made everything seem a little bit better. Her mother was her light in the end of the tunnel What happens when that light is suddenly snatched away from her and she is thrown into the care of nine brothers who she knew nothing about Will Gabriella open up to them or will she still keep her walls up?. Will she learn to trust them or keep her scars to herself? Please read to find out more (•‿•) The chapters are a bit short in the beginning but I promise they'll get longer as you read on
♡ បណ្តូលចិត្តរេរ៉ាវែល ♡ by RydaniaL911
46 parts Ongoing
[ Strange man on a gloomy night ] សុំទោសចំពោះកំហុសអចេតនាណាមួយក្នុងសាច់រឿង
Our angel by Naiwrites2u
50 parts Ongoing
𝐀𝐫𝐢𝐚𝐧𝐧𝐚. For 11 years of her life Arianna has been pushed, beaten and forced to become a top assassin. At the age of 5, little Arianna was kidnapped after witnessing the death of her mother. 𝐀𝐫𝐢𝐚𝐧𝐧𝐚 𝐌𝐨𝐫𝐞𝐭𝐭𝐢. Missing daughter of notorious mafia don Stefano Moretti. Arianna remembers everything. She knows everything about her family (well not everything). Find out what happens when Arianna is thrown back into the arms of her father and brothers. Follow her story of lies, adventure and death as she re discovers her love for her family. Throw in a mysterious boy and overprotective brothers, guns, death and much more in her journey to finding herself.
Reborn Issei (DXD Harem x Reincarnated Issei Male Reader) by MasterOp69
26 parts Ongoing
You died and God said you get to be sent into the DXD world as Issei. Now as Issei you will become the strongest there is with your knowledge of the world and fighting styles from other anime you will be unstoppable.
You may also like
Slide 1 of 10
Homelander: New Legacy cover
ငါလှည့်စားခဲ့တဲ့ဇာတ်လိုက်ပြန်မွေးဖွားလာပြီဟ || ဘာသာပြန် [ Book-2 ] cover
Tensura: The Abyss Demon cover
𝒯𝒽𝑒𝒾𝓇 𝓁𝑜𝓃𝑔 𝓁𝑜𝓈𝓉 𝓅𝓇𝒾𝓃𝒸𝑒𝓈𝓈 cover
The Flash: The Fastest Man Alive (Male Reader Insert) cover
ᴀᴜɢᴜsᴛ | ᴊᴊ ᴍᴀʏʙᴀɴᴋ cover
The Lost De'Luca cover
♡ បណ្តូលចិត្តរេរ៉ាវែល ♡ cover
Our angel cover
Reborn Issei (DXD Harem x Reincarnated Issei Male Reader) cover

Homelander: New Legacy

157 parts Ongoing

When Roger, an ordinary man with an extraordinary heart, is suddenly reincarnated into the body of Homelander, the world's most powerful and controversial hero, he faces an unimaginable challenge. Now endowed with not only Homelander's immense abilities but also Superman's legendary powers, Roger is both shocked and overwhelmed. What will his future hold???

More details