FORESTVALE MANOR
tonyatwraxall
  • Reads 4,332
  • Votes 1,141
  • Parts 72
  • Time 6h 6m
  • Reads 4,332
  • Votes 1,141
  • Parts 72
  • Time 6h 6m
tonyatwraxall
Complete, First published Jun 12, 2023
Mature
dimensionsenemiestoloversfantasyfriendstoloversghostgirlxgirlgoodvsevilhauntedmansionlgbtloveloveatfirstsightmagicmysteryparanormalromancesecretadmirertexttospeechyoungadult
(BETWEEN LIGHT AND SHADOWS 1)
The walls of Forestvale Manor talk to me in whispers that no one else can hear. What should I do, and why do I have to be the hero of this story? I merely wanted to figure out the mysteries of the enigmatic abandoned mansion before starting my new life at university. And now I find myself here, embroiled in a conflict that began who knows when and calls into question my ideals and my understanding of everything that has occurred up to this point. 

Mia.
All Rights Reserved
dimensionsenemiestoloversfantasyfriendstoloversghostgirlxgirlgoodvsevilhauntedmansionlgbtloveloveatfirstsightmagicmysteryparanormalromancesecretadmirertexttospeechyoungadult
Table of contents

72 parts

Sign up to add FORESTVALE MANOR to your library and receive updates
or
Content Guidelines
You may also like
Undead by RA2995
58 parts Complete Mature
Being trapped inside one place most of your life is suffocating. So I took it upon myself to go behind my mother's back every chance I got to leave. I never thought that one day I would be caught. My mother agrees to let me go to school with the neighboring pack's alpha. She only agreed to prove to me that was a monster to other species. To her a Vampire demon should never be left unattended. She may be right most of the times. This time I think my mother could be wrong. Mother doubted me only to be proved wrong. I can coexist with wolves, I've been doing it for years. Now the humans. They are tempting for a hybrid like me. I can push past their tempting blood for 8 hours each day. The thing is I might not want to but I can. Life just keep throwing obstacles my way. Now I have a beloved. An extremely tempting beloved. My demon loves the taste of blood. How long before she gets a taste or our mates?
The Diary Keeper ["The Dark Legacies" Series] by diaryoftheintrovert
68 parts Complete Mature
⭐One day, Liandra's distant wealthy relative dies and the girl inherits a mansion. She finds an old diary of one girl which describes some mystical portals in the house. What is hidden behind its walls?⭐
Behind every mean girl...there's a tragedy by Winchesters_united
33 parts Complete
The average human being spends every second of his day fighting against the force of nature to see another day. But I'm different. I'm not afraid of outside forces to take my life away - only myself. Approximately 10 years ago, something happened to me. Something really bad. But I'm not allowed to talk about it. As a way to release my frustration, I give hell to my body and everyone I come in contact with - especially my parents. No one knows about what happened except the ones who did it...and Him. But he didn't stay. Now, he's back and he's not talking either. I want to stop hurting, I need to stop. Make me stop.
Dark Waters by crusiaa
30 parts Complete Mature
Two best friends who have dark pasts that the other knows nothing about realize their feelings towards each other and decide to give it a try. In a rollercoaster of events they discover the hidden secrets and the main issue becomes the will to fight together when this past comes to haunt them again. Will they be able to fight through it all or will they drift apart. Hey lovelies, this is my first book here and I will appreciate your support and comments here. I hope you enjoy reading😍
THE HEART OF SHADOWS by ke_nzie4u
7 parts Ongoing
"Beyond the veil of the mundane, where shadows danced and whispers spoke secrets, a young woman named [Camilie] stumbled upon a hidden path. A path that led her to the threshold of a realm both wondrous and treacherous - the domain of the Demon King. Here, time was a river that flowed in circles, and the very air was alive with ancient power. And [camilie] was about to find herself swept away by a love that would change the course of her destiny forever."
Your Boyfriend Peter X Female Reader by Lizzessa
112 parts Ongoing Mature
Y/N was not living life. She survived everyday with constant harmful thoughts. How long until her landlord would kick her ass out of the apartment? How many triple shifts until her body refuses and she'd die out of a burnout? Eat.Sleep.Work. That was her schedule. No fun allowed. And when she thinks her life couldn't get any worse a creepy golfball head decided to take more interest in her... More than she'd like... This story contains sensitive topics. The characters in this story belong to their rightful owners.
Obsession - Now a novel by bubblysue
40 parts Complete
On Wattpad as a novella challenged myself to make it a novel. Now complete, self-edited as can't afford one so there will be errors. Any eagle-eyed proofreaders want to help feel free. If you read the original I hope you like this version. Any feedback appreciated. Will leave it here until 2020 and then will probably self-publish. A thin line between love and obsession. Rosalind's father crosses that line. A big house, full of passion and secrets. The silence of shadows deafening. Over-protection is detrimental. Rosalind is loved greatly by her father and Nanny. Rosalind always tries to please and placate him. Who is the lady that appears only to Rosa? Can a father love too much? Would you keep a secret that might ruin your life to protect another? Nanny does for Rosa.
Beyond the Fence: "The House of Whispers" by Vintagevibes111
20 parts Ongoing
When a group of school friends, bound together by their daily bus rides and neighboring homes, stumble upon a dark secret, their curiosity is piqued. One of them, fascinated by the eerie tales, shares the legend of a haunted house beside her bungalow, accessible only by a narrow, steep road. As night falls, strange lights flicker, and whispers spread. The group, fueled by thrill-seeking adventure, decides to explore the mysterious abode, unaware of the terror that awaits them. Will their friendship be strong enough to withstand the horrors beyond the fence, or will the House of Whispers claim them as its own? Join me on a thrilling journey as I recount a chilling tale that's more truth than fiction. While it may be classified as a horror story, fear not! As someone who's lived through it, I can assure you that it's a captivating narrative that will keep you on the edge of your seat without leaving you sleeping with the lights on. So, if you're not typically a fan of horror but love a good story, this is perfect for you. Dive into the mysterious world of 'Beyond the Fence: The House of Whispers' and discover the secrets that lie within.
Starlit Ridge Vol 1 by starlitfox1
27 parts Complete
Hi I'm Starlit Fox I live in a small town called Beast Village. and you won't believe the supernatural beings that live here, but is there why I should be on the run? or will someone save me from evil? find out what happens in the beginning of my story
Unmapped by thatowlet
39 parts Complete
Highest rank #73 in fantasy #18 in voodoo #79 in Philosophy There are times when everything around fades and the voice of the past starts dominating the times. When the waves are lurching high to touch the sky. When you feel the eerie presence within you. Something which is trying to drift away, something tearing you apart. Into two different versions of yourself. What would you do? Destroy the other? or would try to understand it? Love will always be by your side guiding you, showing you path giving you strength, enlightening you. At each and every step. You are risking everything. More precious than your breath. More dangerous than bloodwars. More familiar than unfamiliar. What's going to happen when you are going deeper into the past? What revelations are going to bring it down? What magic is working? Will love save the day? Only the Midnight can tell. Only the Archer can understand. Will they be together in the end? What's going to be unmapped? Catch the Underworld train to know everything;)
You may also like
Slide 1 of 10
Undead cover
The Diary Keeper ["The Dark Legacies" Series] cover
Behind every mean girl...there's a tragedy cover
Dark Waters cover
THE HEART OF SHADOWS cover
Your Boyfriend Peter X Female Reader cover
Obsession - Now a novel cover
Beyond the Fence: "The House of Whispers" cover
Starlit Ridge Vol 1 cover
Unmapped cover

Undead

58 parts Complete Mature

Being trapped inside one place most of your life is suffocating. So I took it upon myself to go behind my mother's back every chance I got to leave. I never thought that one day I would be caught. My mother agrees to let me go to school with the neighboring pack's alpha. She only agreed to prove to me that was a monster to other species. To her a Vampire demon should never be left unattended. She may be right most of the times. This time I think my mother could be wrong. Mother doubted me only to be proved wrong. I can coexist with wolves, I've been doing it for years. Now the humans. They are tempting for a hybrid like me. I can push past their tempting blood for 8 hours each day. The thing is I might not want to but I can. Life just keep throwing obstacles my way. Now I have a beloved. An extremely tempting beloved. My demon loves the taste of blood. How long before she gets a taste or our mates?

More details