Story cover for Her by AbnormalRose
Her
AbnormalRose
  • WpView
    Reads 175
  • WpVote
    Votes 0
  • WpPart
    Parts 6
  • WpHistory
    Time 18m
  • WpView
    Reads 175
  • WpVote
    Votes 0
  • WpPart
    Parts 6
  • WpHistory
    Time 18m
AbnormalRose
Ongoing, First published Jun 30, 2023
16dramadrinkingfightinggaygayawakeninggirlslesbianshsnuffwlw
This is the story of a girl in her first wlw relationship. There are a lot of plot twists and real emotions so get ready to cry !!!
All Rights Reserved
16dramadrinkingfightinggaygayawakeninggirlslesbianshsnuffwlw
Table of contents

6 parts

Sign up to add Her to your library and receive updates
or
#333girls
Content Guidelines
You may also like
Stepsister [GirlxGirl] by livsxl0ve
28 parts Ongoing
its about a girl and her new stepsister, and the drama between them
sweetness and warmth by kyudzai
13 parts Complete Mature
they hate each other. theres nothing but hatred, annoyance and anger. but what happens once the truth gets unraveled, what happens when the two teenage girls eryn and jay have no choice but to confront each other. the two rivals have the pleasure of sharing the same house on a two week class trip, as their arguments get more heated until all the bottled up emotions erupt once and for all. content warnings: - make outs, sexual encounter/smut - swearing - cheating, emotional abuse (not between the protagonists of this story) - mentions of depression and anxiety - verbal fight sequence disclaimer: this story is in no way supposed to fetishize wlw relationships. i myself am lesbian and have no intentions of giving a wrong picture. if you have any issues with homosexuality kindly fuck off pls <3
Bubblegum bitch by tipsy-mermaid
16 parts Complete
Heartbreak girl gets her heart broken
NewLight Recovery by justgetlit
10 parts Complete Mature
A group of girls, each with a different addiction, go to a support meeting at a community center to try and get their life back together , but when they can't leave will they sink back into their addictions or overcome them altogether? Tw* will be listed per chapter , but as a general thing. Triggering story. Proceed with caution. Mainly a wlw story 👩‍❤️‍💋‍👩 I don't actually read before posting so there's probably mistakes, just pretend there isn't
Night Like That (gxg) by OreOJunkIe78
24 parts Complete Mature
When two best friends end up sharing a night filled with pleasure, one confronts feelings she never knew she had and the other tries to hide feelings she always knew she had. • #1 in office romance?! #1 in sapphic?!
What Lies Beneath The Lips(girlxgirl) [Completed] by kaity290
23 parts Complete Mature
Innocent jilliana has fallen for the new girl in school and is trying really hard to keep it a secret from her friends and families. Meanwhile the bad boy has a thing for abusing her. But let's just say she's in for a big surprise.
Its gay idk what else to say by citrus3301
10 parts Complete
This is my first story ever please no bulli ;w; if you want to contact me my instagram is @themofrog my discord is citrus#1025 When Claire flirts with Lily in art class and it backfires miserably she thinks there's 0 chance Lily will ever like her back. But as fate would have it, they are forced to work in a group project together. As they spend more time together Lily realizes Claire isn't as bad as she thought...
IN EVERY UNIVERSE [Oneshots] by AnnayaRevilya
29 parts Ongoing
A FayeYoko One shots. Expect the unexpected storyline, this is not your typical stories so read at your own risks. Thanks for reading ❣️
You may also like
Slide 1 of 8
Stepsister [GirlxGirl] cover
sweetness and warmth cover
Bubblegum bitch cover
NewLight Recovery cover
Night Like That (gxg) cover
What Lies Beneath The Lips(girlxgirl) [Completed] cover
Its gay idk what else to say cover
IN EVERY UNIVERSE [Oneshots] cover

Stepsister [GirlxGirl]

28 parts Ongoing

its about a girl and her new stepsister, and the drama between them

More details