Tokyo Blue Complex | SUNKI
von_ghost
  • Reads 9,786
  • Votes 922
  • Parts 4
  • Reads 9,786
  • Votes 922
  • Parts 4
von_ghost
Complete, First published Jul 22, 2023
Mature
andteamcrimeenhypenmafianikiperseguiçãoromancesunkisunootokyovingançayakuza
O único objetivo de Sunoo era curtir o show da sua banda favorita na noite mais quente de Tóquio. 

Ele só não esperava se envolver em uma perseguição caótica ao lado de Nishimura Riki. - o filho mais novo da máfia japonesa. 



Von_Ghost | 2023
All Rights Reserved
andteamcrimeenhypenmafianikiperseguiçãoromancesunkisunootokyovingançayakuza
Table of contents

4 parts

Sign up to add Tokyo Blue Complex | SUNKI to your library and receive updates
or
Content Guidelines
You may also like
LAST TOUCH [희승]ᴇɴ⁃ by dwlskysoo
36 parts Complete
He has no idea how much the girl wanted to touch his skin and tuck her head on his embrace. he pushed her but she still manages to stay with him- because she believed that both of them will end up together. "how long will this unrequited love end? "𝑼𝒏𝒕𝒊𝒍 𝒉𝒆 𝒂𝒍𝒍𝒐𝒘𝒔 𝒎𝒆 𝒕𝒐 𝒕𝒐𝒖𝒄𝒉 𝒉𝒊𝒎." touch? "𝑯𝒆 𝒘𝒐𝒖𝒍𝒅 𝒏𝒆𝒗𝒆𝒓 𝒂𝒍𝒍𝒐𝒘 𝒂𝒏𝒚𝒐𝒏𝒆 𝒕𝒐 𝒕𝒐𝒖𝒄𝒉 𝒉𝒊𝒎 𝒆𝒙𝒄𝒆𝒑𝒕 𝒔𝒐𝒎𝒆𝒐𝒏𝒆 𝒉𝒆 𝒍𝒐𝒗𝒆𝒅." START: 24.4.2021 END: 19.5.2021 HIGHEST RANKING: #1 KPOP #1 Heeseung #1 Engene #1 Sunoo #1 Iland #1 Kpopfanfic #1 Bighit #1 Straykids #1 Gfriend #1 Playful #1 Jay #1Belift #2 Nuest #2 Niki #2 Jake #3 Hybe
PLAYBOY [제이크]ᴇɴ⁃ Vol.2 by dwlskysoo
29 parts Complete Mature
what happens if you were forced to get married to the most popular actor in South Korea, Jake Shim, and dump the person you have been waiting for years, Lee Heeseung? HIGHEST RANKING : #1 JAKE #1 Fanfiction #1 ILAND #1 Sunghoon #1 Jungwon #2 Jay #2 ENHYPEN #2 Playboy #6 KPOP #10 POV START : 24.12.2020 END : 21.1.2021 - new version: 14.6.2022 end: 2.8.2022
Hired To Love by JordanLynde
66 parts Complete Mature
Henley agrees to pretend to date millionaire Bennett Calloway for a fee, falling in love as she wonders - how is he involved in her brother's false conviction? ****** Henley Linden's brother is in jail for a crime he didn't commit, and she'll take any job to raise the money needed to free him. Soon, she's agreed to pretend to date millionaire Bennett Calloway for ten thousand dollars, so his mother will ease up the pressure on him to find a wife. But once Henley is enmeshed in Bennett's world, he falls for her, and she starts to have feelings for him as well. Despite her romance with Bennett, as she grows closer to the Calloways, Henley realizes they are somehow involved in her brother's conviction. Journeying deeper into a world of wealth and conspiracies, Henley is forced to rely on Bennett, though doing so could cost her everything. [[word count: 200,000-250,000 words]]
WHEELCHAIR [니키] ᴇɴ⁃ by dwlskysoo
35 parts Complete
A story of a girl was facing a critical accident in her life, was needed to be in the wheelchair because of the bad condition of her both legs. when everyone was leaving her behind and treating her harshly, there was a guy who accepted her at her worst. would you believe if the school bad guy accepts her at her worst? STARTED: 30.7.2021 ENDED: 25.8.2021 HIGHEST RANK: #1 Kpop #1 Enhypen #1 Sunghoon #1 Belift #1NiKi #1 Heeseung #1 Kpopfanfic #1 ilandfanfic #1 jungwon #1 Nishimurariki #2 Enhypenfanfiction #2 youth #2 Nikifanfic #3 Iland #5 fanfiction
Ace by antoniawritess
100 parts Complete Mature
[COMPLETE][EDITING] Ace Hernandez, the Mafia King, known as the Devil. Sofia Diaz, known as an angel. The two are arranged to be married, forced by their fathers, joining the two Mafia's. But Sofia eventually learns, even the devil was once an angel. Cover by @alluringathena *This book is more of a romance book than Mafia book and I hope you enjoyyy*
MISTRESS OF FLAME by CeCeLib
82 parts Complete
[ BOOK 1 OF AZITERA: YTHER'S QUEEN ] Consumed by avarice, the four human kingdoms-the Infernal Empire, the Kingdom of Caelum, the Kingdom of Treterra, and the Nayale Archipelago-betrayed their covenant with Yther of Azitera, the race blessed by deities, who protected humans for untold centuries. They slaughtered and defiled the beings that once protected them from storm, famine, poverty, and pestilence without mercy. Betrayed by the humans they protected, the Ytherians were enslaved. Their four queens were caged, chained, and imprisoned to serve as nutrients to the human kingdoms. The once prominent Ytherians were reduced to nothing but servants. As the four kingdoms of the human race prospered for many years since their betrayal, one news staggered them, causing them to tremble in fear and rally their armies to protect and defend their domain: Sollel-the Mistress of Flame, one of Yther's queens-had escaped her prison. Her flames will raze hell, ready to burn the souls of her betrayers. COMPLETED CECELIB | C.C. COVER: ASTRID JAYDEE
ONLY YOU [ 제성크 ]ᴇɴ⁃ by dwlskysoo
50 parts Complete
-JASUKE- In which a girl who thought she was the extra character that everyone used to get closer to the heather, not knowing that there were men who fell in love with her secretly. HIGHEST RANKING: #1 Jay #1 Jake #1 Sunghoon #1 Jongseong #1 Jungwon #1 Bighit #1 Niki # 1 KpopFanfic #1 Jasuke #1 Jay Park #1 Iland #1 kpop2020 #3 ENHYPEN #22 KPOP START : 25.11.2020 ENDED : 20.12.2020 NEW VERSION•• START:22.5.2021 ENDED: 19.6.2021
THE START [성훈]ᴇɴ⁃VOL.2 by dwlskysoo
27 parts Ongoing
And high up above, or down below When you're too in love to let it go But if you never try, you'll never know Just what you're worth HIGHEST RANKING: #1 ILAND #1 ParkSunghoon #1 Jaypark #1 Crush #1 Sunoo #1 Jungwon #1 Jongseong #1 Yangjungwon #2 Sunghoon #2 ENHYPEN #2 Bighit #3 School #15 Kpop START: 1/6/2024 END: 19/7/2024
You may also like
Slide 1 of 8
LAST TOUCH [희승]ᴇɴ⁃ cover
PLAYBOY [제이크]ᴇɴ⁃ Vol.2 cover
Hired To Love cover
WHEELCHAIR [니키] ᴇɴ⁃ cover
Ace cover
MISTRESS OF FLAME cover
ONLY YOU [ 제성크 ]ᴇɴ⁃ cover
THE START [성훈]ᴇɴ⁃VOL.2 cover

LAST TOUCH [희승]ᴇɴ⁃

36 parts Complete

He has no idea how much the girl wanted to touch his skin and tuck her head on his embrace. he pushed her but she still manages to stay with him- because she believed that both of them will end up together. "how long will this unrequited love end? "𝑼𝒏𝒕𝒊𝒍 𝒉𝒆 𝒂𝒍𝒍𝒐𝒘𝒔 𝒎𝒆 𝒕𝒐 𝒕𝒐𝒖𝒄𝒉 𝒉𝒊𝒎." touch? "𝑯𝒆 𝒘𝒐𝒖𝒍𝒅 𝒏𝒆𝒗𝒆𝒓 𝒂𝒍𝒍𝒐𝒘 𝒂𝒏𝒚𝒐𝒏𝒆 𝒕𝒐 𝒕𝒐𝒖𝒄𝒉 𝒉𝒊𝒎 𝒆𝒙𝒄𝒆𝒑𝒕 𝒔𝒐𝒎𝒆𝒐𝒏𝒆 𝒉𝒆 𝒍𝒐𝒗𝒆𝒅." START: 24.4.2021 END: 19.5.2021 HIGHEST RANKING: #1 KPOP #1 Heeseung #1 Engene #1 Sunoo #1 Iland #1 Kpopfanfic #1 Bighit #1 Straykids #1 Gfriend #1 Playful #1 Jay #1Belift #2 Nuest #2 Niki #2 Jake #3 Hybe

More details