Monster Lover (Monsters x Reader)
WittyKa
  • Reads 21,666
  • Votes 268
  • Parts 16
  • Time 3h 18m
  • Reads 21,666
  • Votes 268
  • Parts 16
  • Time 3h 18m
WittyKa
Ongoing, First published Jul 29, 2023
Mature
alienangelcentaurcreaturesdemondragondriderelffairyfairytaleskelpiekrakenkrampusmermaidmermainmermanminotaurmonstersmonsterxreadermythologynagaorc
This is my first Reader book so bear with me.

I'll be doing like a one-shot book. Every chapter is a different creature or every two chapters if I do 2 parts of one creature. 

I do all sorts of pairs like, boy x boy, girl x girl and boy x girl. If you don't like that, you can leave the book or skip the chapter, that is up to you.

Requests are open at the moment.

Credits to the artists of the pictures I'll be using.

I hope you guys enjoy it :)

Highest Rankings:
12/26/24 - #3 kelpie
11/6/24 - #4 fairytales
12/26/24 - #6 drider
All Rights Reserved
alienangelcentaurcreaturesdemondragondriderelffairyfairytaleskelpiekrakenkrampusmermaidmermainmermanminotaurmonstersmonsterxreadermythologynagaorc
Table of contents

16 parts

Sign up to add Monster Lover (Monsters x Reader) to your library and receive updates
or
Content Guidelines
You may also like
π†πŽπ‘π†π„πŽπ”π’ π…πŽπ‘ π„π“π„π‘ππˆπ“π˜ - druig βœ”οΈŽ by toppertaj
27 parts Complete
An MCU Eternals and Druig x fem!oc book, meaning I make a character, you play them, your love interest is Druig and this story takes place in the movie Eternals. You and Druig have gotten closer throughout time. What happens when he meets someone new and you leave because of that someone? What happens when the team needs you a thousand years later? ─── Β· γ€‚οΎŸβ˜†: *.☽ .* :β˜†οΎŸ. ─── DISCLAIMER: no smut, swearing. Thank you for choosing to read this book! Check out my other ones! (I wrote this before the Saltburn movie) -TAJ Started: January 13th, 2022 Finished: January 27, 2022 Edited: December 16th, 2022
Individual RP by The_Moon_In_Darkness
11 parts Ongoing
Finally made a book that is welcoming to most beings, that does include humans, anthropomorphic beings, robots, alien races, etc. At this time I will not be accepting any non-humanoids(aka animals, just flat out animals). This list may be updated as time goes on. All art is made by me.
Solar Bright by acooktera
9 parts Complete
This is my first attempt to write in Wattpad. It is a #justwriteit for #earthlove Thanks to @andykehoe in ello for the great image. Find him here: https://ello.co/andykehoe I will try to ensure that I finish at least one chapter each week by Saturday. I put out a few chapters in the first week, so you may get more. Chapter 1 is Finished! Chapter 2 is Finished! Chapter 3 is Finished! Chapter 4 is Finished! Chapter 5 is Finished! Chapter 6 is Finished! (Sorry I'm having app problems. If you don't get chapters on time.) Chapter 7 is Finished! Chapter 8 is Finished! Chapter 9 is Finished! The book is FINISHED! This book is getting long, so I'm going to make it into more than one story. Book two will start in a few weeks, as I need to move. Feel free to leave CONSTRUCTIVE comments about the story, letting me know what missing or confusing. I know that some things are odd editing mismatches, so let me know when you find those. ************************* Imagine a world where Jabe and Groot are related. (like http://rebloggy.com/post/doctor-who-gotg-guardians-of-the-galaxy-jabe-groot-i-am-groot/93602366055) Here, we have a story about two young trees. They have Adventures. They fall in love. One's path is a little bit harder than the other's.
The Goddess of Death's Son by Yadryz
40 parts Complete
Dessyr, the son of two poor commoners who has no magical abilities, is fighting as a soldier for the human kingdom, Vessaga, in a war against the kingdom of the beastkin, Descon When a sudden enemy battlemage casts a high ranked spell that wipes out a large portion of the battlefield, he is protected by Gena, a powerful magician and his childhood friend, when she used her magic power to cast a barrier around him. However, the barrier couldn't protect him from the enemy spell. He wakes up in a half awake state in a dark domain, and when he looks up, a beautiful woman with pitch black hair is standing over him. This story follows Dessyr and his new life of adventures and sorrows. I hope you enjoy. Note: I do not own the cover art it belongs to its respective owner
The Kraken Queen by MaddieIvins
9 parts Complete
This is a story I've had written out for awhile. Just finally had the chance to publish it! Hello.. I'm the most feared creature.. Being in the ocean.. I'm half human.. Half fish.. A mermaid.. But a dark one.. Who has full control over The Kraken.. Do I attack ships? Sometimes. Ever fallen in love? No.. My heart was broken.. I thought Love was impossible for me.. Till that one day.. I couldn't help my feelings.. Even though my boss had the same feelings for him.. But what made it hard.. I was a hunted creature.. Could I have a shot at the near impossible?.. Could my heart be fixed?..
π‘Œπ‘Žπ‘›π‘‘π‘’π‘Ÿπ‘’ Γ— π‘…π‘’π‘Žπ‘‘π‘’π‘Ÿ by Lilly22000
25 parts Ongoing
Hello! So, this is my first book! so, Yay! I found the picture on pintrest, if you're on here. feel free to send the link so I can credit you! And, Yeah if this gets popular I'll keep posting πŸ‘‰πŸ‘ˆ thanks for reading this cringey intro, see you in the book
Anime x reader oneshots by fired_clown21
39 parts Complete Mature
I'm not used to writing stories so sorry if they suck. There will be Lots of JoJo's Bizarre Adventure ones.
Supernatural x reader oneshots and imagines by GABBYREJ
35 parts Complete Mature
This is my first book so cut me some slack okay. I'll take into consideration any ideas so if you'd like share them! And if I don't use your idea or I tweak it a bit don't get offended please! Most of these will be one shots unless I get some request for a part two. These are all one-shots although some might sound like they kinda tie together and if that bothers you I'm sorry.
World of Tiber by KingFelixMoon
59 parts Complete Mature
When war is near a group of Elves join together to fight. They all come from different backgrounds and have very different personalities. Follow the Elves as they meet each other and get into danger. Will they be able to save Tiber? Or will countless lives be killed? Will they get captured or killed? Keep reading to find out! *(The chapters change characters Point of Views. The chapter will say whos point of view it is)* *(Each chapter varies in length)* *I do not own any of the pictures I used in this story*
The Eyes of Fate [Beta Chapters] by TeeVee37
6 parts Complete
Humans think they have gained control over this world, turning a blind and nieve eye to the past. The elves are gone, The Unicorns vanished, Mermaids, Fairies, and goblins are thought to be extinct. Now all that remains are the beasts of this world. Dragons have been a part of human mythology for centuries, along with another species, Demons. Now known as Krylocks, an ancient warlord threatens the very existence of all things pure, and two girls stand in his way. The Innocent, and The Shadow. So far I have only completed the first 5 chapters, the rest I will be working on while this is out. I'm releasing this so early for input, just to see what you guys think and what I should change. Oh yeah, and this is my first book ever "Published", so please bear with me. This will be the first book in a two-part epic[genre] novel series, or least that's what I'm planning.
You may also like
Slide 1 of 10
π†πŽπ‘π†π„πŽπ”π’ π…πŽπ‘ π„π“π„π‘ππˆπ“π˜ - druig βœ”οΈŽ cover
Individual RP cover
Solar Bright cover
The Goddess of Death's Son cover
The Kraken Queen cover
π‘Œπ‘Žπ‘›π‘‘π‘’π‘Ÿπ‘’ Γ— π‘…π‘’π‘Žπ‘‘π‘’π‘Ÿ cover
Anime x reader oneshots cover
Supernatural x reader oneshots and imagines cover
World of Tiber cover
The Eyes of Fate [Beta Chapters] cover

π†πŽπ‘π†π„πŽπ”π’ π…πŽπ‘ π„π“π„π‘ππˆπ“π˜ - druig βœ”οΈŽ

27 parts Complete

An MCU Eternals and Druig x fem!oc book, meaning I make a character, you play them, your love interest is Druig and this story takes place in the movie Eternals. You and Druig have gotten closer throughout time. What happens when he meets someone new and you leave because of that someone? What happens when the team needs you a thousand years later? ─── Β· γ€‚οΎŸβ˜†: *.☽ .* :β˜†οΎŸ. ─── DISCLAIMER: no smut, swearing. Thank you for choosing to read this book! Check out my other ones! (I wrote this before the Saltburn movie) -TAJ Started: January 13th, 2022 Finished: January 27, 2022 Edited: December 16th, 2022

More details