Story cover for Tranquility by jasmindeandaauthor
Tranquility
jasmindeandaauthor
  • WpView
    Reads 20
  • WpVote
    Votes 0
  • WpPart
    Parts 6
  • WpHistory
    Time 1h 20m
  • WpView
    Reads 20
  • WpVote
    Votes 0
  • WpPart
    Parts 6
  • WpHistory
    Time 1h 20m
jasmindeandaauthor
Ongoing, First published Aug 15, 2023
Mature
abusivefatheralternateworldfairytalefantasyknightsmagicmedievalnewadultromancetragedy
Elena Ortiz lives every day in fear. At sixteen years old, she has faced more violence than anyone deserves. Each day she counts down to the day she turns eighteen and can escape what should be her home. The only ones getting her through it are her best friends Zoey, and Alonso.

But everything changes one day when after escaping the worst night of her life, Elena and Alonso fall and find themselves in a world that is not their own. Now they must learn to live in this new, medieval world, but not everything is as it seems. 

Trigger warning: This story contains brief scenes of violence and abuse.

NEW Chapters every Friday at 8pm PDT, taking a one week hiatus after every three chapters.

ANNOUNCEMENT: This book will be going on a long hiatus. I make handmade items and this is the busy season of custom orders, pop up vendor events, and basic holiday plans. New chapters will return February 2nd, 2024
All Rights Reserved
abusivefatheralternateworldfairytalefantasyknightsmagicmedievalnewadultromancetragedy
Table of contents

6 parts

Sign up to add Tranquility to your library and receive updates
or
Content Guidelines
You may also like
Raven and Rue // Lindensea 1 by ella_rowan
36 parts Complete
𝗔 𝗯𝗼𝘆 𝘄𝗵𝗼 𝗰𝗮𝗻 𝘁𝗮𝗹𝗸 𝘁𝗼 𝗮𝗻𝗶𝗺𝗮𝗹𝘀. 𝗔 𝗺𝘆𝘀𝘁𝗲𝗿𝗶𝗼𝘂𝘀 𝘆𝗼𝘂𝗻𝗴 𝗺𝗮𝗻 𝘄𝗶𝘁𝗵 𝗮 𝘀𝘁𝗿𝗮𝗻𝗴𝗲 𝗻𝗮𝗺𝗲 𝗮𝗻𝗱 𝗺𝗲𝘀𝘀𝘆 𝗵𝗮𝗶𝗿. 𝗔𝗻 𝗶𝗻𝗱𝗼𝗺𝗶𝘁𝗮𝗯𝗹𝗲 𝗼𝗹𝗱 𝘄𝗼𝗺𝗮𝗻. 𝗔 𝘀𝗮𝗿𝗰𝗮𝘀𝘁𝗶𝗰 𝗺𝗮𝗴𝗶𝗰𝗶𝗮𝗻. 𝗔 𝗰𝗮𝘀𝘁𝗹𝗲, 𝗮𝗻 𝗶𝗻𝘃𝗶𝘁𝗮𝘁𝗶𝗼𝗻 𝘁𝗼 𝘁𝗵𝗲 𝗯𝗮𝗹𝗹, 𝘁𝗵𝗲 𝗰𝗹𝗼𝗰𝗸 𝘀𝘁𝗿𝗶𝗸𝗶𝗻𝗴 𝗺𝗶𝗱𝗻𝗶𝗴𝗵𝘁, 𝗮 𝗹𝗼𝘀𝘁 𝘀𝗵𝗼𝗲 ... 𝗦𝗼𝘂𝗻𝗱 𝗳𝗮𝗺𝗶𝗹𝗶𝗮𝗿 𝘆𝗲𝘁? Pip is the happiest boy in the kingdom of Lindensea, until he loses everything and becomes the saddest boy in the world. Falling in love with a dishevelled young nobleman who is leaving the kingdom seems like a piece of foolishness that will only break his heart. It took hard work and determination for Pip to survive. It will take time, luck, and a sprinkle of magic for a chance at true happiness. But are the stars on his side, or working against him? The question remains: 𝘞𝘩𝘰 𝘪𝘴 𝘙𝘢𝘷𝘦𝘯? 𝘈𝘯𝘥 𝘸𝘩𝘰 𝘪𝘴 𝘙𝘶𝘦? AWARDS 🏆 Winner in Fantasy - Celestia Cove Awards 2024 🏆Winning Finalist in Fantasy - NanoWatt Awards 2023 🎗️ Semi Finalist - Rose Gold Awards 2023 ✨Shortlisted in Fantasy - Amby Awards 2023 27 Major Prizes FEATURES 📖 Newly Written Books - All the Places We Will Go 28/03/2023 📖 Retold - Fractured Fairytales 11/05/2023 📖Magic - Fantasy and Other Worlds (19/10/2023) 📖 TCR Reads - Secret Identities (02/02/2024) 📖 The Reading Room - Feast on Fiction (02/04/2024) 30x Featured Cover design by @AnnamitaMuscaria
Midnight Between Worlds: Shadows of the Lost Realm by kybaby35
70 parts Complete
Just when Elena thought the danger was behind her, the worlds she fought to protect are threatened once again. A hidden realm resurfaces, brimming with forgotten magic, perilous secrets, and enemies who will stop at nothing. Pulled into a battle that tests her heart, mind, and power, Elena must confront truths she never expected-and decide how far she is willing to go to save the worlds she loves. The shadows of the lost realm are waiting... and nothing will ever be the same.
My Fucked Up Fairytale by pinenutters
27 parts Complete Mature
TEASER: "No fiancée of mine needs to learn how to fight." His breath flows upon the prickling skin of my neck. I close my eyes, involuntarily shuddering in response. "All you need to know how to do is satisfy me." "How exactly am I supposed to satisfy you?" The answer to such a question is obvious, yet, like the idiot I am, I still asked him. "Blood...and of course, other means." BLURB: When college student Cyra finds her life falling apart after a brutal breakup, she wishes for an escape-only to awaken in a realm filled with sword-wielding vampires, deadly elves, and more fantastical creatures. Unfortunately for Cyra, she's been chosen to marry a powerful vampire prince... and kill him. Trapped between survival and a dagger with a destiny, she must navigate a world where fairytales come soaked in blood, sarcasm, and forbidden attraction. WARNING: This story contains scenes involving sexual assault/harassment. The chapters containing these potentially triggering subjects all have warnings at the start of them! Please read at your own discretion! RANKINGS: ⭐️#3 in adult - 12/28/23 ⭐️#9 in werewolf - 12/28/23 ⭐️ #4 in mature audience - 4/2/24 ⭐️ #1 in werewolfandvampire -5/27/24 ⭐️ #10 in unrequitedlove - 8/2/24 ⭐️ #1 in adultsituations - 8/5/24 ⭐️ #10 in -romance - 1/4/25 ⭐️ #7 in -romance - 3/18/25 ⭐️ #8 in vampireromance - 5/14/25 ⭐️ #4 in -romance - 9/25/25
CACKLE- Book 1 by JESheppard
42 parts Complete
Just in case you thought it may be too easy growing up in an apocalyptic world, where demons and hellhounds roam free, try adding growing up knowing you're humanity's only hope for salvation. Yeah, okay... no pressure. Remilia's only family is her aunt, Annabella Vikroth, not of blood but of bond. Born with a rare gift, Remilia known as Remi, grew up learning to harness her magic. However, there would be some things even Anna, a seasoned witch, could not teach her. Like, for example, how to control her ability to create all four elements. Just days away from her sixteenth birthday, while most would be preparing to celebrate such a milestone, our sweet Remi will be preparing to travel back in time to stop the death of Eloricia's royal family, and by so doing prevent the apocalypse. If she does not succeed, she already knows what the future holds.
The Modern Countess by AlexiaPraks
87 parts Complete
When life gives you a second chance in a medieval fantasy world, make sure you revolutionize it. Getting hit by a truck wasn't on my post-graduation bucket list. Neither was waking up as Quinn Fairchild, the illegitimate daughter of a cruel lord in a world of magic and monsters. But at least I got some cool magical powers out of the deal, right? Well, sort of. Sure, I can create modern conveniences and heal people, but now I'm being married off to the infamous Earl of Norsewood-a man whose reputation makes hardened warriors tremble. Turns out this supposedly ruthless earl is actually a gorgeous, caring leader desperately trying to save his dying land. Armed with my 21st-century knowledge, a know-it-all magical creation skill, and a determination to build something amazing, I'm turning this medieval fantasy world upside down. One modern convenience at a time. Now if only I could figure out why my hunky husband keeps looking at me like I'm his personal miracle... The Modern Countess Series (formerly Apparently, I'm the Infamous Earl's Legendary Bride) is a fantasy romance series features a vivacious transmigrated heroine determined to revolutionize a medieval-like, war-torn world with her modern knowledge and magical abilities, alongside a hunky warrior-earl husband hell-bent on protecting his land and people while claiming his wife's heart. This series contains: • Slow Burn Romance • Kingdom Building • Magic System • Found Family • Politics & Intrigue • Food & Cooking • Slice of Life Note: A kingdom-building fantasy series follows protagonists as they develop and manage their domain, from humble villages to sprawling empires, while gathering loyal citizens and allies along the way.
Chosen by kall_me_kai
57 parts Complete
Warings: abuse, suicide, self-harm This is an LGBTQ story Scarlett Rose is a princess forgotten by the world. Hidden and abused by her parents, she is finally bartered away in a political marriage to a prince she has never met. Taking her away from her miserable home, Prince Julian Thorn wins, if not her love, then at least her friendship. It's his sister Athena with whom Scarlett really hits it off and the two become fast friends That is, until The Competition is announced. A 'sport' that will prepare one of the Chosen candidates to become a king or queen, and cull the rest. As the newly engaged princess to one of the most powerful kings, Scarlett is almost certain to be one of the Chosen. For the first time in known history, not one, but two princesses are Chosen. Athena and Scarlett will have to compete to survive. What surprises lie in wait for them in The Competition? If one change has been made, what can they still rely on? Within Scarlett hides a secret even she doesn't suspect. Will their new friendship survive this baptism of fire?
My Lady Chef { La Vita Series } - Volume 2 by SeraEnigma
100 parts Complete Mature
Duchess Alaina Aisenburg and her husband Duke Ezran are finally true to their feelings which is the first step to the next chapter of their lives. As they began the next phase of their marriage. The duchess' café business still proves to be a successful venture by everyone who came. But lurking behind their budding relationship are certain forces that wants to tear them apart. Each of them with its own agenda and desires. This is the next phase of their story and it will take more than a frying pan and delicious meals to get them through this. An "isekai" style fantasy adult romance with a delicious twist! [ WARNING! There will be a few chapters with graphic sex scenes. I will mark them as R-18 for those that want to skip. Otherwise, read at your own risk! ] NOTE: THIS IS BOOK 2 of "My Lady Chef" .
When fate go wrong. by devil_princess_xoxo
30 parts Complete Mature
Elena Crystal, a 17 years old girl with many problem in her life. On her 18 birthday, something happen to her. Something she thought is was just a fantasy, a perfect fairy tale her mom use to tell her when she was little. Turn out it a true story and it now happen to her. With enemies she never know that she have and a world she thought never existed. Truths and lies is revealing themselves. New friends, enemies, betrayal, loves, how would she survive? Will she make the right choices? Or will she run from the problem? One wrong choice and the peoples she love and protect will die or worst, the whole world will end. *Warning: Inappropriate language and need a lot of editing so read at your own risk! Thx!
Killian (sample) by ElizabethKelly2
2 parts Complete
Growing up the son of a fairy King - Easy. Being accepted to the fiercest, strongest, fairy warrior army ever to protect the realm - Easy. Making the human girl, who holds your destiny in her hands, fall in love with you - Not so Easy. When the Fairy Kingdom of Avalon comes under attack, Prince Killian, Fairy warrior, and heir to the throne, prepares for battle. But when the prophesy of a Seer overshadows his fate and while his family is dying around him, he flees Avalon to the Human Realm. He vows to return and claim his destiny, only...he never thought his vengeance would mean fifty years stuck in the human realm with no way home. Reagan Lunsa is completely alone and she thinks she likes it that way. She buries her grief from her parents' mysterious disappearance, 3 years ago by keeping busy at her university art school and working at Faircrest's New Age shop. All while secretly spending every free moment on solving the mystery of what really happened to her parents. On a rare night out her attention is caught by a handsome, sexy bartender who seeks her out, asking for friendship, and maybe more. This stranger is unlike any man she's ever known. And when she discovers he's also hiding secrets her world turns upside down, all while she falls deeply in love with this protective, and patient Fairy prince. Reagan finds that learning to trust again is harder than she thought. Especially when the truth, and her love, leads her into a world unlike she has ever known. A world where fairies exist and humans are not welcome.
My Lady Chef { La Vita Series } - Volume 1 by SeraEnigma
147 parts Complete Mature
Elena Valdez was an award-winning chef and a successful food entrepreneur. She had everything; a loving family, good friends and a food empire. Her life was perfect. Until an untimely death landed her not in the gates of heaven but into the body of another person who calls herself Alaina, the Duchess of Aisenburg. That's right. She was reincarnated in La Vita, another world different from Earth and trapped in a life that was new to her. In a realm that actually has monsters, magicks, and mana sprites; she now has another chance at a second life. Can she use her chef skills from her past life to turn things around? Join her as she faces defiant servants, the noble born ladies of high society, deadly enemies and winning the heart of her husband, the intimidating Duke of Aisenburg all while thinking of the next best dish to cook! An "isekai" style fantasy adult romance with a delicious twist! [ WARNING! There will be a few chapters with graphic sex scenes. I will mark them as R-18 for those that want to skip. Otherwise, read at your own risk! ] NOTE: THIS IS VOLUME 1 of "My Lady Chef" .
You may also like
Slide 1 of 10
Raven and Rue // Lindensea 1 cover
Midnight Between Worlds: Shadows of the Lost Realm cover
My Fucked Up Fairytale cover
CACKLE- Book 1 cover
The Modern Countess cover
Chosen cover
My Lady Chef { La Vita Series } - Volume 2 cover
When fate go wrong. cover
Killian (sample) cover
My Lady Chef { La Vita Series } - Volume 1 cover

Raven and Rue // Lindensea 1

36 parts Complete

𝗔 𝗯𝗼𝘆 𝘄𝗵𝗼 𝗰𝗮𝗻 𝘁𝗮𝗹𝗸 𝘁𝗼 𝗮𝗻𝗶𝗺𝗮𝗹𝘀. 𝗔 𝗺𝘆𝘀𝘁𝗲𝗿𝗶𝗼𝘂𝘀 𝘆𝗼𝘂𝗻𝗴 𝗺𝗮𝗻 𝘄𝗶𝘁𝗵 𝗮 𝘀𝘁𝗿𝗮𝗻𝗴𝗲 𝗻𝗮𝗺𝗲 𝗮𝗻𝗱 𝗺𝗲𝘀𝘀𝘆 𝗵𝗮𝗶𝗿. 𝗔𝗻 𝗶𝗻𝗱𝗼𝗺𝗶𝘁𝗮𝗯𝗹𝗲 𝗼𝗹𝗱 𝘄𝗼𝗺𝗮𝗻. 𝗔 𝘀𝗮𝗿𝗰𝗮𝘀𝘁𝗶𝗰 𝗺𝗮𝗴𝗶𝗰𝗶𝗮𝗻. 𝗔 𝗰𝗮𝘀𝘁𝗹𝗲, 𝗮𝗻 𝗶𝗻𝘃𝗶𝘁𝗮𝘁𝗶𝗼𝗻 𝘁𝗼 𝘁𝗵𝗲 𝗯𝗮𝗹𝗹, 𝘁𝗵𝗲 𝗰𝗹𝗼𝗰𝗸 𝘀𝘁𝗿𝗶𝗸𝗶𝗻𝗴 𝗺𝗶𝗱𝗻𝗶𝗴𝗵𝘁, 𝗮 𝗹𝗼𝘀𝘁 𝘀𝗵𝗼𝗲 ... 𝗦𝗼𝘂𝗻𝗱 𝗳𝗮𝗺𝗶𝗹𝗶𝗮𝗿 𝘆𝗲𝘁? Pip is the happiest boy in the kingdom of Lindensea, until he loses everything and becomes the saddest boy in the world. Falling in love with a dishevelled young nobleman who is leaving the kingdom seems like a piece of foolishness that will only break his heart. It took hard work and determination for Pip to survive. It will take time, luck, and a sprinkle of magic for a chance at true happiness. But are the stars on his side, or working against him? The question remains: 𝘞𝘩𝘰 𝘪𝘴 𝘙𝘢𝘷𝘦𝘯? 𝘈𝘯𝘥 𝘸𝘩𝘰 𝘪𝘴 𝘙𝘶𝘦? AWARDS 🏆 Winner in Fantasy - Celestia Cove Awards 2024 🏆Winning Finalist in Fantasy - NanoWatt Awards 2023 🎗️ Semi Finalist - Rose Gold Awards 2023 ✨Shortlisted in Fantasy - Amby Awards 2023 27 Major Prizes FEATURES 📖 Newly Written Books - All the Places We Will Go 28/03/2023 📖 Retold - Fractured Fairytales 11/05/2023 📖Magic - Fantasy and Other Worlds (19/10/2023) 📖 TCR Reads - Secret Identities (02/02/2024) 📖 The Reading Room - Feast on Fiction (02/04/2024) 30x Featured Cover design by @AnnamitaMuscaria

More details