Story cover for Expectations When Expecting by NyxNightshade0128
Expectations When Expecting
NyxNightshade0128
  • WpView
    Reads 195,919
  • WpVote
    Votes 8,216
  • WpPart
    Parts 92
  • WpHistory
    Time 10h 30m
  • WpView
    Reads 195,919
  • WpVote
    Votes 8,216
  • WpPart
    Parts 92
  • WpHistory
    Time 10h 30m
NyxNightshade0128
Ongoing, First published Aug 17, 2023
daddirecrowleydirecrowleyisntbaddisneytwstfirstfanficisekaimagicstupidideabutbearwithmeteenteenpregnancytwistedtwistedwonderlandtwst
"Memories of the previous hour danced across her memory like a flurry of snowflakes in a snowstorm. Images of a white and azure colored clinic and a doctor smiling assuredly while she delivered hopeful and terrifying news to her. 

Pregnant? Her? She was only nineteen!

She felt as the tears welled in her eyes, threatening to overflow. Her mind raced, remembering her fiancé, recently deceased in a car accident, and she bit her tongue. I'm scared... "

~~~
Having lost her partner and father of her unborn child, Yuu is faced with terrifying news that will affect her life. As she returns from the clinic, she notices the eerie feeling of the familiar dirt road when she sees an ebony carriage rushing toward her. What happens when she wakes up in an unfamiliar, magical place that has never heard of her home? What's worse; she's in an all boys school.
All Rights Reserved
daddirecrowleydirecrowleyisntbaddisneytwstfirstfanficisekaimagicstupidideabutbearwithmeteenteenpregnancytwistedtwistedwonderlandtwst
Table of contents

92 parts

Sign up to add Expectations When Expecting to your library and receive updates
or
#141direcrowley
Content Guidelines
You may also like
TWISTED WONDERLAND HEADCANNONS (REQUESTS CLOSED) by Lemon0Bear11
27 parts Complete Mature
Hello my little cuties! 🥰 Oneshots and headcannons of your precious twisted wonderland bois!!!
The Alternative Solution by NEosHoward
23 parts Ongoing Mature
The System made an oops! After accidentally killing Lucy due to a system malfunction, the only solution was to plop her into a new life to make up for the mistake. Suddenly waking up as Rachel, an abusive wife to five husbands in a world of monsters, primaries, man-beast hybrids, and technology unlike anything she's ever seen - Lucy has to navigate how to survive until she can figure out how to get home. All of my stories feature LGBTQ+ characters: in this novel the MCs are pansexual and polyamorous, several of the MCs are intersex, and much of the supporting cast is also LGBTQ+. TW: This book contains discussions of abuse and trauma, sexual content, and other adult themes. Chapter releases are weekly (Fridays!) Awards/Recognitions: * The Starfish Awards 2025 (Best Ensemble) - 2nd Place Contests/competitions this story is participating in: * The Turquoise Quill Awards 2025 * Wattpad Gem Awards 2025 * Tea Time Romance awards 2025 * The Freedom Awards 2025 * 8 Chapter Challenge
The Modern Countess by AlexiaPraks
87 parts Complete
When life gives you a second chance in a medieval fantasy world, make sure you revolutionize it. Getting hit by a truck wasn't on my post-graduation bucket list. Neither was waking up as Quinn Fairchild, the illegitimate daughter of a cruel lord in a world of magic and monsters. But at least I got some cool magical powers out of the deal, right? Well, sort of. Sure, I can create modern conveniences and heal people, but now I'm being married off to the infamous Earl of Norsewood-a man whose reputation makes hardened warriors tremble. Turns out this supposedly ruthless earl is actually a gorgeous, caring leader desperately trying to save his dying land. Armed with my 21st-century knowledge, a know-it-all magical creation skill, and a determination to build something amazing, I'm turning this medieval fantasy world upside down. One modern convenience at a time. Now if only I could figure out why my hunky husband keeps looking at me like I'm his personal miracle... The Modern Countess Series (formerly Apparently, I'm the Infamous Earl's Legendary Bride) is a fantasy romance series features a vivacious transmigrated heroine determined to revolutionize a medieval-like, war-torn world with her modern knowledge and magical abilities, alongside a hunky warrior-earl husband hell-bent on protecting his land and people while claiming his wife's heart. This series contains: • Slow Burn Romance • Kingdom Building • Magic System • Found Family • Politics & Intrigue • Food & Cooking • Slice of Life Note: A kingdom-building fantasy series follows protagonists as they develop and manage their domain, from humble villages to sprawling empires, while gathering loyal citizens and allies along the way.
Glory for the Thorn empire (twisted wonderland fanfic)) by Mushroomchild96
6 parts Complete
join me for a story of Yuu. a human teleported into a new world of twisted wonderland. but what if this place wasn't new. what if he had been here before. join Yuu as he finds am old friend, finds a family, and maybe love along the way. This is only a short story. ((This is a story will not follow the main story of Twisted Wonderland. Only the characters will stay the same. I own nothing but my interpretation and version of yuu))
𝘼𝙩𝙩𝙧𝙖𝙘𝙩𝙞𝙤𝙣 // [Semi-Yandere] Twst x reader by YAENJU
31 parts Ongoing
𝗠𝗮𝗴𝗶𝗰𝗹𝗲𝘀𝘀. Yup that was how everyone in NRC describes you as. But one thing about you is that, you are quite lucky. How? well your parents are beautiful their beauty was out of the earth. That's how people would tell you, a child of the sun and the deep ocean. Something that could blind you and find you peace, everything was perfect. 𝗣𝗿𝗼𝗯𝗹𝗲𝗺 𝘄𝗮𝘀. That you didn't come to NRC on your own will. Actually you got teleported here with out your will, it was sad and all but. At least you got to enjoy your day's with companies surrounding you, atleast you weren't particularly lonely. 𝗕𝘂𝘁 𝘆𝗼𝘂𝗿 𝗯𝗲𝗮𝘂𝘁𝘆. Attract quite the unpleasant side of them. And you being dumb and all, didn't notice that. Even if you were smart, you won't even figured it out. How could a dumb boy/girl ever realised that? That's just their point ln view, what about your view? 𝗪𝗶𝗹𝗹 𝘆𝗼𝘂 𝗲𝘀𝗰𝗮𝗽𝗲 𝗯𝗲𝗳𝗼𝗿𝗲 𝘁𝗵𝗲𝘆 𝗵𝘂𝗻𝘁 𝘆𝗼𝘂 𝗱𝗼𝘄𝗻 𝗮𝗻𝗱 𝗸𝗲𝗲𝗽 𝘆𝗼𝘂 𝗳𝗼𝗿𝗲𝘃𝗲𝗿? 𝗢𝗻𝗹𝘆 𝘁𝗶𝗺𝗲 𝘄𝗶𝗹𝗹 𝘁𝗲𝗹𝗹... Made by - Shu Xuyin. Made in - 29/1/2023.
Luminous by jeidafei
156 parts Ongoing Mature
Born with glowing green eyes. Destined for rotten luck. Peasant girl Meya Hild was 'given' the opportunity to become a Lady. At swordpoint. By mercenaries. Engaged to a dying nobleman. Poisoned with one month to live. Tasked to loot a castle. In a kingdom running out of resources. Little did Meya know this shenanigan would lead her across land and over sea, from a mountain made of sapphire to an island shrouded in spiral clouds, with masquerades, heists, kidnappings, shipwrecks, alchemy, romance, and an unexpected 'bump' along the way. Let the misery begin. 🐉 🎯 PROGRESS: Book One (Chpt. 1 - 65): 100% Book Two (Chpt. 66 - 125): 100% Bingers, YOUR TIME HAS COMETH. Playlist: https://open.spotify.com/playlist/7iYf3f78K4QInWwpz6z3Mp?si=35Rt2vgkTryCM3vD9eKVXA&pi=cE-JGby3RgeKW 🎨 Cover: @NamtanTangren / Namtan [糖人] https://www.deviantart.com/tangrennamtan 📋 Content Guidelines: Most chapters are safe for work/school. Chapters containing intimate scenes will be marked with ❣️ Although not depicted explicitly, this story touches on mature subject matter such as depression and suicide, drug addiction and overdose, human trafficking, organ harvesting, abortion and rape. It's also loosely based on medieval times, and some scientific misbeliefs (concerning health and pregnancy, etc.) are present. Young readers are urged to use discretion. ⭐ DOs & DON'Ts ⭐ 💖DO: Add LUMINOUS to your library & follow me so you don't miss any updates! 💖DO: Comment away! I love answering them. Please be polite and respectful! 💖DO: If you enjoyed Meya's adventure, spread the word! 🚫DON'T: SKIP THE PROLOGUE! You have been warned by the dragons that be that you will regret it! Why don't I just rename it "Chapter 1"? BECAUSE PROLOGUE SOUNDS COOLER!
When The Night Burns by yoonhiii
16 parts Complete
"I loved you across seven lifetimes... even when you didn't remember me." Yuhi was never just an ordinary woman - not in this life, or the six before it. Cursed to forget the man she once loved, she is haunted by dreams of fire, war, and a knight with eyes that never leave her soul. Demon has lived in silence, watching her reborn again and again, always hoping this will be the life she remembers him. But fate is cruel, and love has a rival: the half-demon prince who cursed them both, all because he couldn't stand to lose her. In this seventh life, everything begins to unravel - when a brave boy named Arav calls them both "mom" and "dad" and risks everything to break the cycle that binds them.
(Discontinued) Adventurer || Twisted Wonderland x Male Reader by KingRiceBall
9 parts Complete
You find yourself in a body that does not seem to belong to you, and yet you have little to no control over it either. You, the reader, have been observing your vessel for months now, soon turning into a year, and you find yourself influencing his thoughts and decisions every now and then in public. Only when you are alone can you control his body. But that is all it has amounted up to.. so why is it that you can suddenly control his body as if it is your own now?! After a black carriage suddenly appeared at the Driscoll manor, surprising both you and your vessel, whom you learned was Azaki Driscoll a little after being transport into his body. Azaki had been much too curious for his own good and resulted in this.. unfortunate situation. The start of this story will mainly be introducing the family of the body you'll be inhabiting, so you won't be transferred to Night Raven right away, so you can get used to the names of your family members and you can decide if you like my writing style or not. Also, Yuu will still be included, since you, the mc, will have magic in your new body/vessel. This is the first story I've written and I'm not too experienced in writing at all. I won't have a set updating schedule but I'll try my best to get atleast two chapters out a week, if I have the time and motivation. This is a TWST X Male Reader story. I haven't seen many of these so I've decided to write one for all of our wonderful male readers out there that are looking for this kind of story. If there's anything that you all find offensive or any wrong facts, please tell me but do be polite about it, and don't fight in the comments. I doubt that'll happen because from what I've seen, you all are pretty chill- Anyways, I'm blabbering, onto the story! Also, Twisted Wonderland and none of the characters nor any of the pictures beling to me, only the Driscoll family does.
A WHOLE NEW WORLD || Reader X BTS || by purplewinxx
24 parts Ongoing
A fantasy au Y/n has always felt like life was unfair; always filled with hardships and doubts. Feeling out of place in her own home. "No one ever wanted you!" The words haunted her every single day. A constant reminder of being a burden never surprises her. The sense of belongingness, a foreign concept to her. She knew that and she accepted that but what happens when that changes? "Where are you taking me?!" "Where you belong." A place no one have ever heard of. A place of wonders far from her wildest dreams. For the first time, she thinks she might have finally found a place to call home but... Life is not all rainbows and sunshine. "I trusted you!" Her voice broke as she collapsed to her knees, the door slamming shut behind her. The journey has just begun. In this world of wonders and mysteries, the path to fit in is full of ups and downs. "I can't do it!" "Yes you can! And you will!" Prepare for the journey of finding the purpose of your life. For it might not be so simple. Started: 7 Jan 2025 Ended: **The images and gifs used in this story belong to their rightful owners**
The Dark Magician Girl ⭐️ | COMPLETE by qstarfire
27 parts Complete
~Wordzmith Awards Winner~ ~Draft 2~ ~Draft 1: Editing Complete~ ~A Fire Emblem FanFic~ The Dark Magician Girl Book 1 "The world surrounding me fades away into darkness. My father's voice slowly disappears. His touch is no longer there. I hear nothing. I feel nothing. I see nothing. I feel my mind descending into darkness and my mind slowly being consumed. It feels as though it is an eternity. I start to feel less and less, then my emotion is completely gone. I remember nothing. I open my eyes. I see nothing. The edges of my vision are red and fuzzy. There is a black figure standing before me, and is smiling with a shrieking laughter filling the air. 'There you are, my child,' " ~The Dark Magician Girl ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~Contains Fire Emblem Characters and my OCs in a Fire Emblem World~ Star's father banishes her to another world, similar to her own but with minor differences. Star begins her journey to find a way back to her world. Will she find what she seeks? Star is a stubborn child. All of her life, Star has been used to compressing her emotions to keep her magic under control. During her journey, Star learns how complex emotions really can be. Most importantly, love. Will she learn to control her emotions? Or will she be lost in the alternate realm forever? ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ The following is of my own work. This book may not be reproduced or used in any manner without the written permission of the creator, only as conversation or comments. This is a work of fiction, any resemblance to actual persons or events is purely coincident. ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ Original Start Date: 20 October 2015 Publication Date on Wattpad: 30 October 2015 Completion Date: 10 January 2016 ------------------------------------------------------- Copyright © 2015-2016 by qstarfire. All rights reserved. -------------------------------------------------------
Crowley's Adoptive Daughter in Night Raven College by AnniePaul5
27 parts Complete Mature
A female from another world's accepted into Night Raven College and now she needs to focus as the males want to impregnant her, but she's not interested as she rejects them all repeatedly as she's not interested in them making them to be shocked as they wonder what's on her mind to be like this fully. It's all just about training and studying. With her familiar Grim by her side, she'll be fine. Can a sorting octopus mermaid and Hade's descendent get her to accept them as her lovers or will she be stuck as she is fully? She's not going back to her old home world once school's over as it's no longer existing!
Mysteries Within [Twisted Wonderland x Male Oc] by RavenTheLazy
101 parts Complete
Future Me Note: ok so, the first few chapters may not be that good, but it gets better, i swear! 😅 and slow updates FUTURE FUTURE ME NOTE: my writing sucks here holy shit, read at your own risk man Shune Sorishida, comes from a different world. A world far greater than the twisted world of wonderland. He gets transported as he finds himself in a coffin. Making friends along the way, but also enemies. Although, he isn't alone, he has a little companion right by his side. Whom will stick with him to the bitter end! As he is from a different world, overblotting due to excessive use of magic doesn't apply to him. Even so, he still faces hardship on his journey. To some, on the outside, he's calm and collected. But on the inside lies many mysteries... but, let me tell you this, his impact on the twisted world of wonderland is huge. Its almost as if,... he was ꋊꏂ꒦ꏂꋪ ꇙ꒤ꉣꉣꄲꇙꏂ꒯ ꓄ꄲ ꏂꉧ꒐ꇙ꓄ ꒐ꋊ ꓄ꁝꏂ ꊰ꒐ꋪꇙ꓄ ꉣ꒒ꋬꉔꏂ. Although, he seems like a kind soul, who he truly is... is a secret to outsiders. Hiding the truth from his... "friends" Why, might you ask? Well why don't you find out yourself? After all, this journey will be a new one im sure you'll enjoy Disclaimer: Twisted wonderland or any images used does not belong to me! Only Shune! This is an oc insert!! There will be cussing. Will not be following the story plot exactly since this will be mostly Shune's POV. (Since i've already seen so many follow the same path 🗿) ⚠️ Love interest thing is purely for funsies and won't actually be related to the cannon story ⚠️ TW!!! Verbal Abuse/Abuse(?)... mention's of violence. (I mean, there are overblots in the story... what would you expect?...) death
When the Night Burns by MapleMihi
16 parts Complete
"I loved you across seven lifetimes... even when you didn't remember me." Yuhi was never just an ordinary girl - not in this life, or the six before it. Cursed to forget the man she once loved, she is haunted by dreams of fire, war, and a knight with eyes that never leave her soul. Demon who has lived in silence, watching her reborn again and again, always hoping this will be the life she remembers him. But fate is cruel, and love has a rival: the half-demon prince who cursed them both, all because he couldn't stand to lose her. In this seventh life, everything begins to unravel - when a brave boy named Arav calls them both "mom" and "dad" and risks everything to break the cycle that binds them. Love doesn't always arrive in a single lifetime. But when the night burns - it remembers. #
Raising a Hero by LoweFantasy
77 parts Complete
She had only wanted to have a working marriage and a happy family. Despite that, her husband leaves her for another woman after the loss of their unborn child, and just as she starts to pick herself up, she dies in a car crash. But this isn't the end of her story. Her spirit is picked up by her brother, a beginner god who needs help raising the hero of his fledgling world. Thinking he is offering her an opportunity to be a mother, she readily agrees, and he sends her down to his world with the gift of healing and a semi-ageless body to aid her on her quest. She quickly finds her little boy and is overjoyed to have someone to baby at last. But this hero doesn't want her as his mother. He wants her as something else. DISCLAIMER!!! This is the first 77 chapters of a 241 chapter book! You can get it for cheapity cheap on Amazon (ebook and hardcopy) or pay by the chapter on other sites. It's called 'Google it.' I advise the Amazon route, because we poor folk need to stick together.
The Child of Yakumo in a Shattered World (slow updates) by Powerkfinal
56 parts Ongoing Mature
No lemons planned, don't think I'd be good at them so uhhhhh yeah A child. That is what they found in the remains of an island off the coast of ||||||, if you can even call it that. A writhing mass of this... void was all that was there, and the child smack dab in the middle of it, drifting about in pain. But unknown to them, their survival will lead to a massive chain of events, and the uncovering of the truth of another world. A world where mankind faces beasts armored with bone. Their fate is bound to the Yakumo, and bound to their one true home. Their origin and their heart will never be the same. Such is the cost of the eyes that can perceive death. I will change things from the show, and take liberties with the source materials I am drawing from. This is my first story, please cut me some slack. Slow updates, tons to manage rn #1 in Male Reader 5/19/23 #2 of Inprocess 8/29/24 #1 in Tsukihime 6/1/24 #1 in Touhou Project 7/3/24
You Only Live Twice (Discontinued-ish) by knightlilies
31 parts Ongoing
Olivia was your average 18 year old girl. Keyword, 𝙬𝙖𝙨, until she drowned in a lake and woke up in a crappy novel her friend recommended to her. The character she'd been convinced to read it for ended up being a small-time, side villain that disappeared half-way through the story, Olivia Auclair, the duke's sickly eldest daughter with the same first name as her. And just as her luck would have it, she now is living as that Olivia. Truthfully, she barely knew what she was getting into or why she was sent here after death in the first place. The only recollection she had of the story was the spoiled, self-centered heroine, Angelica, with a generic backstory and extremely overpowered abilities, the main characters who surround her, and of course, her hatred for the fictional book. Her saving grace to stay alive and well? Well of course it is to befriend the two most prominent characters within her reach, the antagonist and the male lead. Both of which eventually would be roped into the heroine's harem, but if all went right then hopefully by then she wouldn't have anything to worry about. Unfortunately, her plan backfired some where along the way, and now she is faced with the heroine's silent wrath and jealousy, her pawns overprotectiveness, an adopted noble's persistence, family drama, and the ever enclosing end of the story. What's a girl to do in her second life except lie down and accept her impending doom? -> Currently being rewritten!!! <-
For the second lead's sake by Nouschka09
27 parts Complete Mature
🥇The Slowest Burning Romance Book of the Week Award🥇 She wanted to save her favorite fairytale character, the derelict second male lead. To rescue the kidnapped princess, he went as far as sacrificing his one-of-a-kind magical companion. But at the end, she married the crown prince of the neighboring kingdom. Just because one was born as the king's son, he got the main lead position. The orphan stood at the second place, despite being a prodigy in swordsmanship. She could not bear to see the second male lead dying all alone and broken-hearted. So, I helped her change the fate of the second lead. *************************************************** Disclaimer: This story will contain depictions of child abuse, violence and death. Reader discretion is advised. I'm not a native English speaker. Please excuse the grammatical mistakes and do not hesitate to let me know if you find one! Best ranking: #1 second male lead syndrom (2025-11-06) #1 magical creatures (2025-11-11) #2 fantasy creatures (2025-11-06) #3 swordsman (2025-11-26)
Really Riley: The Memory That Binds Us by Vlynnzee
30 parts Ongoing
He remembers everything. She doesn't even know his name. In a kingdom ruled by bloodline and power, Riel-heir to the ruthless Desillix Dukedom-has been given the unthinkable: a second chance. Haunted by war, loss, and a love he failed to protect, he awakens in a time before everything shattered. Before he lost her. Riley has no memory of the boy who once bled for her. But when their paths cross again, something stirs-something warm, familiar... and terrifying. As shadows from the past begin to resurface, their connection is tested by secrets, sacrifice, and the very power that once bound them together. When memory is the only thread left, and love itself is a risk-can they defy fate, or are they destined to fall apart once more? I've put a lot of thought into reworking the characters and story arcs-hope you enjoy this new and improved Really Riley!
Young Love, Young Family by Katsuma8
18 parts Complete
THIS WAS MY FIRST EVER STORY LIKE THIS!! I HATE IT MYSELF! IT SUCKS Don't worry, I am redoing this story completely, none of this stuff will be there. None of the pregnant at 14, the omegaverse (I'm not into that type of story anyways, so it'll be fem deku i think) If you want to follow the process go to "Young Love", that will be the updated version. If you want to message me privately, my discord is dakota5635 and my facebook is Dakota Elliot. Sure to say "Young Love" When first messaging me about adding or fixing something, just so that I know what it is about :)
The Definition of Dysania (A Collection of Short Trepidations) by Nightingale_Nebula
31 parts Complete
What is your greatest fear? You might be able to find it here. What is the most peculiar situation you can think of? What would you do if you were thrown into it, from below or above? The best way to learn is by experience dysania will be found within these pages. A collection of fears I found tossed aside, Overcome, because their owners died. Simulations of situations that no one wants to be in, But you'll never know until the moment when you fall. If you fail to prepare, you prepare to fail. So what are you waiting for? What if the world got tinged with a color that could kill? It's a Red Maelstrom. What if you died like a cartoon character? What an Unfortunate Ending. What if you became a pop star? I'd be a Shooting Starlet. What if you were a bird in the apocalypse? How long could you Fly? Highest Ranks: #1 in Abstract #1 in Social Justice Awards: 1st place in The Peach Soda Awards
You may also like
Slide 1 of 20
TWISTED WONDERLAND HEADCANNONS (REQUESTS CLOSED) cover
The Alternative Solution cover
The Modern Countess cover
Glory for the Thorn empire (twisted wonderland fanfic)) cover
𝘼𝙩𝙩𝙧𝙖𝙘𝙩𝙞𝙤𝙣 // [Semi-Yandere] Twst x reader cover
Luminous cover
When The Night Burns cover
(Discontinued) Adventurer || Twisted Wonderland x Male Reader cover
A WHOLE NEW WORLD || Reader X BTS || cover
The Dark Magician Girl ⭐️ | COMPLETE cover
Crowley's Adoptive Daughter in Night Raven College cover
Mysteries Within [Twisted Wonderland x Male Oc] cover
When the Night Burns cover
Raising a Hero cover
The Child of Yakumo in a Shattered World (slow updates) cover
You Only Live Twice (Discontinued-ish) cover
For the second lead's sake cover
Really Riley: The Memory That Binds Us cover
Young Love, Young Family cover
The Definition of Dysania (A Collection of Short Trepidations) cover

TWISTED WONDERLAND HEADCANNONS (REQUESTS CLOSED)

27 parts Complete Mature

Hello my little cuties! 🥰 Oneshots and headcannons of your precious twisted wonderland bois!!!

More details