╰•★ρєтυαℓαηgαη кαмι★•╯ ✩ɢᴇɴꜱʜɪɴ ɪᴍᴘᴀᴄᴛ x ʀᴇᴀᴅᴇʀ✩
meow_starss
  • Reads 172
  • Votes 11
  • Parts 2
  • Reads 172
  • Votes 11
  • Parts 2
meow_starss
Complete, First published Aug 21, 2023
actionadventureaetherauboygroupdramafanficfanfictionfantasifantasyfiksipenggemarfriendshipgenshingenshinimpactgirlgroupkisahluminemihoyomodernmodernteyvatpaimonpetualanganxreader
══╡☆★ɢᴇɴꜱʜɪɴ ɪᴍᴘᴀᴄᴛ x ʀᴇᴀᴅᴇʀ ᴍᴏᴅᴇʀɴ ᴀᴜ★☆╞══

Disini adalah petualangan [Name] bersama para karakter Genshin. [Name] mempunyai banyak teman saat di sekolah Teyvat. Dan petualangan lainnya akan menanti bersama teman-temannya. [Name], Aether, Lumine dan Paimon yang akan menemani petualangan Name disekolah maupun di beberapa tempat yang pastinya akan lebih seru. 

Dan petualangan Name disekolah akan ditemani oleh Grup Anemo Boys, Grup DCKZ, Grup Sumeru Boys dan Grup Teyvat Girls dan beberapa teman lainnya yang akan menemani petualangan [Name] disekolah. 

Dan juga [Name] akan menemukan beberapa banyak petualangan yang menantikan kehadiran nya disana.

Bagaimana keseruan [Name] di sekolah Teyvat dan petualangan lainnya yang akan menemani nya di beberapa tempat yang berbeda?
Nantikan keseruan nya!!!
All Rights Reserved
actionadventureaetherauboygroupdramafanficfanfictionfantasifantasyfiksipenggemarfriendshipgenshingenshinimpactgirlgroupkisahluminemihoyomodernmodernteyvatpaimonpetualanganxreader
Table of contents

2 parts

Sign up to add ╰•★ρєтυαℓαηgαη кαмι★•╯ ✩ɢᴇɴꜱʜɪɴ ɪᴍᴘᴀᴄᴛ x ʀᴇᴀᴅᴇʀ✩ to your library and receive updates
or
#722kisah
Content Guidelines
You may also like
The Exiled Alpha | ✓ by Silverless
37 parts Complete
"It's like he's a different breed of werewolf. Something... beyond us." • • • Adrienne Gage has spent her entire life being shunned and punished for her mouthy attitude, and being loyal to a pack which doesn't deserve her loyalty. It's been a year since her last punishment, and she's been walking on eggshells to keep herself in the clear. But now, that's all being threatened to be taken away if she doesn't abide by what the Alpha's son wants; and that's her as his Luna. At the same time, terrified whispers are circulating around. Mentions of a tyrant Alpha looking for a new pack to conquer. Adrienne thinks nothing of everyone else's paranoia. That is until she finds herself half conscious and being dragged away deeper into the woods with canines around her neck. Highest Ranking #1 in Paranormal Highest Ranking #1 in Werewolf Highest Ranking #1 in Romance Cover made by @Silverless COMPLETED
MISTRESS OF FLAME by CeCeLib
82 parts Complete
[ BOOK 1 OF AZITERA: YTHER'S QUEEN ] Consumed by avarice, the four human kingdoms-the Infernal Empire, the Kingdom of Caelum, the Kingdom of Treterra, and the Nayale Archipelago-betrayed their covenant with Yther of Azitera, the race blessed by deities, who protected humans for untold centuries. They slaughtered and defiled the beings that once protected them from storm, famine, poverty, and pestilence without mercy. Betrayed by the humans they protected, the Ytherians were enslaved. Their four queens were caged, chained, and imprisoned to serve as nutrients to the human kingdoms. The once prominent Ytherians were reduced to nothing but servants. As the four kingdoms of the human race prospered for many years since their betrayal, one news staggered them, causing them to tremble in fear and rally their armies to protect and defend their domain: Sollel-the Mistress of Flame, one of Yther's queens-had escaped her prison. Her flames will raze hell, ready to burn the souls of her betrayers. COMPLETED CECELIB | C.C. COVER: ASTRID JAYDEE
「𝐢𝐫𝐫𝐞𝐬𝐢𝐬𝐭𝐢𝐛𝐥𝐞」𝘦. 𝘫𝘢𝘦𝘨𝘦𝘳 by twilightx_
66 parts Complete Mature
𝐈𝐫𝐫𝐞𝐬𝐢𝐬𝐭𝐢𝐛𝐥𝐞: "𝘛𝘩𝘢𝘵 𝘴𝘮𝘪𝘭𝘦 𝘰𝘯 𝘺𝘰𝘶𝘳 𝘧𝘢𝘤𝘦 𝘮𝘢𝘬𝘦𝘴 𝘪𝘵 𝘦𝘢𝘴𝘺, 𝘵𝘰 𝘵𝘳𝘶𝘴𝘵 𝘺𝘰𝘶." 𝘴𝘵𝘢𝘳𝘵𝘦𝘥: 12/9/2020 𝘦𝘯𝘥𝘦𝘥: 3/22/2021
After by imaginator1D
114 parts Complete
Tessa Young is an 18 year old college student with a simple life, excellent grades, and a sweet boyfriend. She always has things planned out ahead of time, until she meets a rude boy named Hardin, with too many tattoos and piercings who shatters her plans.
The Alpha King's Mate by Bookdragon2022
32 parts Complete
"Y-your H-highness? I-i'm sorry b-but t-there m-must b-be a-a m-mistake..." A loud growl sounded through the whole ballroom causing me to start shaking and a whimper to escape my lips. This caused the King to stop growling. He pulled me to his chest and yelled out to the whole ballroom. "MINE!" Audrey is an Omega in the Rapid River Pack. Lucas is the Alpha King, Ruling over all and his own pack, The Moonlight Eclipse Pack. Audrey is beaten daily loosing all hope of every meeting her mate. Lucas just wants his mate but feels like she doesn't exist. What happens when the two meet at the Annual Lunar Eclipse Ball? Credits to @M_Rainberry for the amazingly wonderful cover!!!
Teach Her ✔️ by pocketbangtan
49 parts Complete
"Screw the rules. I want you, Kim Y/N." THIS FIC WAS MADE INTO CLICKBAIT FOR A YOUTUBE VIDEO COMPLAINING ABOUT KOREABOOS LOLLL ITS NOT THAT BAD GIVE IT A CHANCE you can find an audio cover on TerryTV :) Highest Ranking : [#1 in Fanfiction] BTS Park Jimin x reader High school teacher AU Translations: Spanish
Criminal by sujinniie
63 parts Ongoing
"Bad guys can be good too... when they're in bed." #1 in FANFICTION✓ © sujinniie 2018-2019 ✓ © sujinniie revised 2022
Steal The Male Lead by Shellyrill
200 parts Complete
The main character always ends up with the male lead? Even if they're backstabbing, evil, and cruel, they will live happily ever after just because they are the main character? Even if they're so innocent that they cause countless deaths, they will still be treated with love and respect, with everyone groveling at their feet to help them. Well, the readers have agreed to disagree with this thought. It's about time to revolt! Alright then, we just need someone to destroy the main character. We need to take away the main character's golden thigh. Since that's the case, we need to Steal The Male Lead. AN: Hello everyone, so this is going to be my third book ever written on Wattpad. I've actually had plans for this book for a while and I also have many ideas for the other arcs but, please enjoy the book, and I will try to keep a constant update on it. *If any of the photos are yours or you know that the artist of the photos or characters don't want it up, please comment down right away so that I can delete it. None of the photos are mine and rightfully belong to the artist.*
[BL] Rebirth of the Little Mute by Erishi_An
95 parts Complete
Rebirth of the Little Mute 重生之小哑巴 Author(s) 穆青延 Status in COO 93 + 2 Extras (Completed) Description Mu Xiaoke was a fool in his previous life, but he couldn't help and his older brother both fell in love with Fu Jiayun. He is a little mute who's a total failure, how could the other party choose him? He shouldn't compete with his older brother, or marry the Rong family as a substitute for his older brother, otherwise he wouldn't die alone in the wilderness and his corpse wouldn't be found. God gave him a chance to be reborn. When he returned to his first year in senior high school, he knew that he could not repeat the same mistakes again. He had to stay away from his older brother, Fu Jiayun, and Rong Yanzhe. The person who treated him as a stand-in for his older brother and kept abusing him. This time, he didn't ask for anything, as long as he could live well. It just didn't occur to him that when he kept a respectful distance from those people, they instead came to pester him endlessly. He was in panic and unexpectedly provoked another man who shouldn't be approached... --- NOTE: FOR OFFLINE PURPOSES SO DON'T REPOST MTLED IF YOU DON'T UNDERSTAND THEN IT IS IN POOR QUALITY I DID THIS FOR PEOPLE LIKE ME WHO CAN'T AFFORD PROPERLY TRANSLATED AND LIMITED INTERNET CONNECTION SO PLEASE DON'T CRITICIZE THE QUALITY NOR THE WAY I MTLED IT THANK YOU
50 Shades of Ackerman {Modern Levi x Reader} by heichouthot
31 parts Complete
50 shades of Gray, but with you and Levi Ackerman.
You may also like
Slide 1 of 10
The Exiled Alpha | ✓ cover
MISTRESS OF FLAME cover
「𝐢𝐫𝐫𝐞𝐬𝐢𝐬𝐭𝐢𝐛𝐥𝐞」𝘦. 𝘫𝘢𝘦𝘨𝘦𝘳 cover
After cover
The Alpha King's Mate cover
Teach Her ✔️ cover
Criminal cover
Steal The Male Lead cover
[BL] Rebirth of the Little Mute cover
50 Shades of Ackerman {Modern Levi x Reader} cover

The Exiled Alpha | ✓

37 parts Complete

"It's like he's a different breed of werewolf. Something... beyond us." • • • Adrienne Gage has spent her entire life being shunned and punished for her mouthy attitude, and being loyal to a pack which doesn't deserve her loyalty. It's been a year since her last punishment, and she's been walking on eggshells to keep herself in the clear. But now, that's all being threatened to be taken away if she doesn't abide by what the Alpha's son wants; and that's her as his Luna. At the same time, terrified whispers are circulating around. Mentions of a tyrant Alpha looking for a new pack to conquer. Adrienne thinks nothing of everyone else's paranoia. That is until she finds herself half conscious and being dragged away deeper into the woods with canines around her neck. Highest Ranking #1 in Paranormal Highest Ranking #1 in Werewolf Highest Ranking #1 in Romance Cover made by @Silverless COMPLETED

More details