WALLPAPER VINYL GEOMETRIC KRISTAL
wallpaper87
  • Reads 1
  • Votes 0
  • Parts 1
  • Time <5 mins
  • Reads 1
  • Votes 0
  • Parts 1
  • Time <5 mins
wallpaper87
Ongoing, First published Aug 30, 2023
wallpaperwallpapergeometricwallpapermalangwallpapervinyl
Wallpaper vinyl adalah wallpaper yang terbuat dari bahan vinyl. Wallpaper vinyl ini terkenal memiliki ketahanan yang cukup relatif lama. Selain itu wallpaper vinyl harganya sangat terjangkau. Wallpaper vinyl jika di pegang atau di raba akan berasa teksturnya.

Apakah kamu sedang mencari cara baru untuk menghadirkan suasana segar di dalam ruanganmu? Kami punya solusi yang tepat untukmu! Wallpaper vinyl geometric kristal dari WallpaperIndonesia.id akan memberikan sentuhan istimewa dan modern pada ruangan favoritmu. Dengan desain yang elegan dan motif yang menawan, wallpaper ini akan mengubah tampilan ruanganmu menjadi lebih menakjubkan. 

Dibuat dengan bahan vinyl berkualitas tinggi, wallpaper ini tidak hanya memberikan tampilan yang mewah, tetapi juga tahan terhadap goresan dan noda. Dengan perawatan yang mudah dan daya tahan yang luar biasa, kamu dapat menikmati keindahan ruanganmu dalam jangka waktu yang panjang.
All Rights Reserved
wallpaperwallpapergeometricwallpapermalangwallpapervinyl
Table of contents

1 part

Sign up to add WALLPAPER VINYL GEOMETRIC KRISTAL to your library and receive updates
or
#25wallpapervinyl
Content Guidelines
You may also like
Wendizzy's Writer Room by Wendizzy
2 parts Ongoing
In this book, you'll get a behind the scenes look at how your favorite characters were born, my creative process, and the dirty details never before revealed. Tex's Camp Q&A: Come sit by the fire and ask me whatever you'd like. We can roast marshmallows, tell scary stories, and hang out in the comments like a big, happy family. Gator's Backstage Pass: A place full of secrets. Learn the-sometimes embarrassing-details on how my wildest scenes came to life, facts about the characters, the process, and myself.
You may also like
Slide 1 of 1
Wendizzy's Writer Room cover

Wendizzy's Writer Room

2 parts Ongoing

In this book, you'll get a behind the scenes look at how your favorite characters were born, my creative process, and the dirty details never before revealed. Tex's Camp Q&A: Come sit by the fire and ask me whatever you'd like. We can roast marshmallows, tell scary stories, and hang out in the comments like a big, happy family. Gator's Backstage Pass: A place full of secrets. Learn the-sometimes embarrassing-details on how my wildest scenes came to life, facts about the characters, the process, and myself.

More details