Dead Meme Rising
MrMCppman
  • Reads 4
  • Votes 0
  • Parts 1
  • Time <5 mins
  • Reads 4
  • Votes 0
  • Parts 1
  • Time <5 mins
MrMCppman
Ongoing, First published Sep 14, 2023
afterlifeapocalypsedeadmemesdeathfirememememesviolince
The story about Dead memes and where they go
Public Domain
afterlifeapocalypsedeadmemesdeathfirememememesviolince
Table of contents

1 part

Sign up to add Dead Meme Rising to your library and receive updates
or
#31deadmemes
Content Guidelines
You may also like
True Magician by dbelphegor
78 parts Ongoing
Waking up in the body of a Romani Archiman is acceptable. Getting 3rd and 1st True Magics is nice. Getting Beasts as pets - delightful. The world of DxD is unforgivable. It's a world where some teenagers who aren't even two decades old somehow mystically defeat the descendants of legendary heroes, ancient demons, powerful dragons, etc. Why does this happen? Simply because! Simply put, this world only makes sense because it doesn't. And now, I have to put up with the fact that I live here. Such pain. (DxDxMulti)
Infinite Magic (Male Reader x Harry Potter) by MegaMess21
124 parts Ongoing
YN Gojo, the first Gojo clan member to possess both Six Eyes and Infinity for generations, goes to Hogwarts!
Game of Thrones: King of Magic by dbelphegor
61 parts Ongoing
Westeros is a land where intrigue, conspiracy and gold rule. A land where everyone has to look twice to avoid being stabbed in the back. A land that never expected one "insignificant" event - the arrival of a Pseudo-Servant capable of single-handedly destroying its foundations. With the knowledge of the modern world and the Servant's abilities, what changes will he make? And is Westeros ready for those very changes?
The Undetermined || pjo by TeenWriter77
62 parts Ongoing
Liz is an unclaimed kid with no family and no idea of who she is. Her only home is Camp Half-Blood When Camp is at risk of being in the middle of a war because of the Gods that don't care about her, she will not sit back and watch as it happens. WARNING! ‼️ Violence-Curses-Deaths-mentions of suic!des-suic!des attempts
Metropolis Heroes! - A Sonic Movie and DC Super Hero Girls Crossover by Sonicspeedstar
27 parts Ongoing
(After the events of "Knuckles" and before "Sonic the Hedgehog 3") What do you get when you mix three mobians and six suddenly magically and pretty automatically teenagers with a hint of humor from Rise of the Teenage Mutant Ninja Turtles? You get a mixture of chaos! After moving from the small town of Green Hills, Montana to the big city of Metropolis, Sonic, and his friends/brothers, Tails and Knuckles, are struggling with their new life in the big city, starting at a new school, which is as boring as it sounds, but after a food fight occurs they meet the Super Hero Girls! Who Team Sonic end up teaming up with for some amazing and awesome adventures while taking down new and powerful threats! It's a new city with the same old Sonic Heroes! I do NOT own these characters! The Sonic Movies are owned by Paramount Pictures, Original Film, & SEGA DC Super Hero Girls is owned by Cartoon Network, DC, Warner Bros. Animation and Lauren Faust Disclaimer!: The story for people 13 & up, as some episodes contain mild foul language, innuendo, inappropriate jokes and remarks, sneaky retorts and suggestions about sex, and some PG-13 moments (Making-out, swearing, and a bit of blood). You have been warned.
Izuku Midoriya: the truest hero of all time. by Sneakerheadmaster16
8 parts Complete
Izuku Midoriya formerly izuku yagi had a good life up until he was diagnosed quirkless. He was neglected and beaten by his own (all might and magnetic) family and (1A) friends. Over the years izuku learn how to defend himself in private, read comics from before quirks were around and learning about heroes quirks. One day, while izuku is running away from his tormentors, he runs into the forest to lose them. After he does he realizes he's lost and then he sees a meteor coming towards him. After it crashes izuku feels like it's calling to him, he goes near it and almost in an instant he feels a sudden surge of power and strength he never felt before. Now with these new abilities he will become the next number one hero and symbol of hope.
Wings of the Grand Line | One Piece x Male Reader by LaidbackGiraffe
25 parts Ongoing
"Could these people bring justice to my home?" After barely escaping his homeland, (Y/N) wandered the Grand Line, searching for those who could help him right the wrongs he had witnessed. Every step of his journey exposed him to more corruption, injustice, and evil, but it also showed him how wonderful the world could be. One fateful day, he crossed paths with a peculiar crew of pirates who called themselves the "Straw Hats." They were unlike any pirates he had ever encountered. __________________________________________________________________________________ I don't own the characters or the story of One Piece. All rights belong to the owners.
Blossom In Adversity - Vol. 2 by CeritanyaNyai
176 parts Ongoing
Blossom in Adversity (TV Drama Title) Cherishing Hua Zhi (Original Novel Title) Synopsis: After hiding her skills for fifteen years, Hua Zhi thought she could live a peaceful life as a proper daughter of a prestigious family. However, when the Hua family's fortune began to decline, she had to reveal her true abilities to support the crumbling household. It became common for her to step forward and take charge, to gallop on horseback, and even to carry a coffin with her siblings to face desperate situations. Her reputation as someone not to be crossed spread throughout the city of Beijing. She was prepared for the possibility of her family turning against her, and she was prepared to grow old alone. What she didn't expect was for someone to don armor and pledge a lifetime to her before heading off to battle! It was quite rare for someone to dare marry her in this world!
Ash And Horizons by Rekuta1
52 parts Ongoing
Ash Ketchum has finished the world championship, but that also means he's closer to be a pokemon master. He already continue his adventure after his depart with Goh and Chloe, but he also already finished his other adventure. Ash don't know what to do after beating the championship, but it looks like Delia able to step ahead and give Ash something to do: a School life. The story will be having Ash in Pokemon Horizon, but i'll try to make Ash character better in this story Also Ash and Liko are 10 years old cuz some people in discord sat i should add it in description.
𝐌𝐈𝐒𝐓 𝐎𝐅 𝐓𝐇𝐄 𝐍𝐈𝐆𝐇𝐓 hwang jun-ho. by LEMONDXOP
25 parts Ongoing
Into the ashen night, of a billion stars, the serendipity of duality that is our shared existence, is both futility and eternal hope, the road that belongs to immortals. ──────────── 𝐌𝐈𝐒𝐓 𝐎𝐅 𝐓𝐇𝐄 𝐍𝐈𝐆𝐇𝐓 In which a desperate police officer brings his only support mechanism, his best friend and his partner to a deadly mission. #1 junhoxreader 11.20. 21 (Hwang Jun-Ho x reader) STARTED 10.18.21 ~ waiting for season 2
You may also like
Slide 1 of 10
True Magician cover
Infinite Magic (Male Reader x Harry Potter) cover
Game of Thrones: King of Magic cover
The Undetermined || pjo cover
Metropolis Heroes! - A Sonic Movie and DC Super Hero Girls Crossover cover
Izuku Midoriya: the truest hero of all time. cover
Wings of the Grand Line | One Piece x Male Reader cover
Blossom In Adversity - Vol. 2 cover
Ash And Horizons cover
𝐌𝐈𝐒𝐓 𝐎𝐅 𝐓𝐇𝐄 𝐍𝐈𝐆𝐇𝐓 hwang jun-ho. cover

True Magician

78 parts Ongoing

Waking up in the body of a Romani Archiman is acceptable. Getting 3rd and 1st True Magics is nice. Getting Beasts as pets - delightful. The world of DxD is unforgivable. It's a world where some teenagers who aren't even two decades old somehow mystically defeat the descendants of legendary heroes, ancient demons, powerful dragons, etc. Why does this happen? Simply because! Simply put, this world only makes sense because it doesn't. And now, I have to put up with the fact that I live here. Such pain. (DxDxMulti)

More details