Silk & Steel
CharliForge
  • Reads 8
  • Votes 0
  • Parts 12
  • Time 1h 0m
  • Reads 8
  • Votes 0
  • Parts 12
  • Time 1h 0m
CharliForge
Ongoing, First published Oct 07, 2023
fanfictionfantasykeladryknightsmagicmiddlegrademindelanswordandsorcerytamorapiercetortall
Daughters of the Warrior Class

It's been 15 years since Keladry of Mindelan earned her shield. Since then, more and more girls have been following her example.

Now it's time for the next generation. Sabine-Haname of Queenscove and Princess Lianokami of Conté are taking their first steps towards knighthood.
All Rights Reserved
fanfictionfantasykeladryknightsmagicmiddlegrademindelanswordandsorcerytamorapiercetortall
Table of contents

12 parts

Sign up to add Silk & Steel to your library and receive updates
or
#7tamorapierce
Content Guidelines
You may also like
Brooklyn Archer //Book One// - Legends of Tomorrow - COMPLETED by MCWAYY
29 parts Complete
19 year old Brooklyn is in for a wild ride when time-master Rip Hunter recruits her to save the future. I DO NOT own Legends of Tomorrow, I only own Brooklyn and her story.
Blood Royals Book #4: Long Live The King! by jmhallewell
52 parts Complete Mature
The members of the House of Kaelan have become accustomed to never catching a break in their dramatic life. From the sudden death of a king, an attempted assassination of the prince, a rogue power hungry princess to battling for the throne, they are only beginning.
Bloodthirsty for Blood is Redundant by Faithshieldmaiden
29 parts Complete
As the neglected daughter of a Warlord in a time where war is a way of life and Warlords live like kings, Brynnhilde Derroarian's penchant for killing people to defend her home, killing people, to defend her family, killing people who insult her, killing people who - yeah, just killing people in general - and general bloodthirstiness is enough to convince her father to let her be trained as the first female shield warrior. But when he leaves her at home while he takes his troops to war and the other side of his territories are attacked, Brynnhilde's penchant for bloodthirstiness is all that stands between her people and the slaughter that awaits them as the hands of the villainous Niatarians. After she captures a castle by killing a giant that just won't die - don't ask - and a line of morons - yes, they lined up - the newly dubbed "The one who is Bloodthirsty for Blood" must keep her title, even if it gets very redundant.
The Rise of a Hero & The Garnet Nightshade: A Violet Rose (Book 2) by Axel_Blinston
15 parts Complete
Many years have passed in the Garnet Nightshade domain, and the children of Elise and Mira are all grown up. Alyssa and Arsidian now defend and rule the domain, but troubles brew across the sea among the beast-folk. When the elven princess Sidora and her retainer, Amber visit Garnet Nightshade, they make more than simply diplomatic contact with the Lis'ra heirs. What does the future bode for these young leaders, and fate is in store for Garnet Nightshade?
The Warrior Princess (Discontinued) by pxrfectly_sxrene
17 parts Complete Mature
"Young Girls are told to be delicate princesses but you can be a warrior." ⭕✴⭕✴⭕✴⭕✴⭕✴⭕✴⭕✴⭕✴⭕✴⭕ A warrior is born. Destined to be a killer from start. Betrayals rise all around Kneazleland as friendship and love blossoms. There is a will to fight, but is there a way to win? The destined one finds everything mysterious as history repeats itself. Old friendships must be rekindled, myths have to be believed, fighting to be learned, killing to be braced as there is no other way to escape the ruin. Will She show the world, what she-power is? Will She change the view of the world regarding women? Read to find out. ~❤~ The Warrior Princess ~❤~ ★Highest Rank(s): ~1st in #restrictions ~1st in #femalerights 3rd Place Winner in Four Seasons Awards for Action genre This is a work of fiction. ✔Genre: Fantasy ✔Subgenre: Action/Teen fiction Wonderful Cover by @-DeelsDead- ⚠Mature for Depictions of Violence. Warning given before the respective chapter starts...⚠
gilded lily, p.jackson by bvrryl0ves
23 parts Ongoing Mature
❛and here you come, with a shield for a heart and a sword for a tongue. ❜ ttc - currently writing tbl - tlo - percy jackson x fem!oc
10 Years Time by justkending
20 parts Complete Mature
As princess of Alberia, it is your duty to grow into a rightful young lady if you plan on ruling your family's country. Of course, the only way your father can see this happening is sending you off to a boarding camp at the age of 14 for 10 years to learn what it means to grow into a Queen.That means leaving all your friends and family behind. One specific person, your best friend, you never want to say goodbye to. But 10 years later, you come back grown into a young lady, and find your best friend has grown into a knightly young man. How will you two adjust after 10 years apart? Will things be the same, or will all that's happened in that span of time affect your relationship? *I do not write smut, so warnings are for language and triggers*
Becoming Her Knight by kitty-maine
15 parts Ongoing Mature
Finnea has been in the army of Queen Titania since she was old enough to hold a sword. Even if it was never a life she would have chosen for herself, she was used to it and even excelled at it. But when she's promoted to the position of knight and given her first solo mission, she is forced into a situation she could never have anticipated. Now she has to travel with the beautiful daughter of the man she was tasked with killing and has to decide between loyalty to her queen and family or to her heart. (Updates on Mondays.) (Check out my patreon for early release chapteres, extras and deleted scenes! https://www.patreon.com/KittyMaine)
The Monarch | ✓ by JessaKaina
25 parts Complete
Years after the loss of their beloved King and Queen, the regency in Kaurtyn now has five months to prepare for the crowning of their new monarch. Neighbouring kingdoms are planning to strike while the monarchy in Kaurtyn is at its weakest, under the rule of a young queen. Navigating her impending royal duties with her friends at her side, the threat looming over Kaurtyn has Princess Malia wondering who truly has her, and the kingdom's, best interests at heart. Unraveling the secrets of the kingdom means more than discerning ally from foe. Becoming a monarch will have Malia finding the truth about her lineage, the hidden troubles of her kingdom, and the path that follows her heart. Can Malia be the monarch her kingdom deserves, or will another ruler seize her crown and end her parent's legacy? Great if you love: medieval fantasy, YA fiction, queens, first loves, and friendship. [Cover Photo Credit]: Bestbe Models, Pexels
Avalon: Princess (Avalon, #1) by sr_ahuja
19 parts Complete
After a rash decision, Jade finds herself stuck in Avalon, the land of the fairies. Until now, Jade had lived as an orphan and an outcast. Now, she will find out what it's like to live as the daughter of the King and train to one day serve as the Queen, but when she shirks her duties and ventures into the forbidden land, Lyonés, she discovers something she was never meant to find. Avalon: Princess is also available as a free Kindle book from Smashwords and it is available as a paperback on Amazon. If you enjoy this book, check out the sequel, CROWN coming later this year!
You may also like
Slide 1 of 10
Brooklyn Archer //Book One// - Legends of Tomorrow - COMPLETED cover
Blood Royals Book #4: Long Live The King! cover
Bloodthirsty for Blood is Redundant cover
The Rise of a Hero & The Garnet Nightshade: A Violet Rose (Book 2) cover
The Warrior Princess (Discontinued) cover
gilded lily, p.jackson cover
10 Years Time cover
Becoming Her Knight cover
The Monarch | ✓ cover
Avalon: Princess (Avalon, #1) cover

Brooklyn Archer //Book One// - Legends of Tomorrow - COMPLETED

29 parts Complete

19 year old Brooklyn is in for a wild ride when time-master Rip Hunter recruits her to save the future. I DO NOT own Legends of Tomorrow, I only own Brooklyn and her story.

More details