Story cover for Vysarria: The Wanderer by AttaccHelicopter
Vysarria: The Wanderer
AttaccHelicopter
  • WpView
    Reads 323
  • WpVote
    Votes 3
  • WpPart
    Parts 7
  • WpHistory
    Time 1h 32m
  • WpView
    Reads 323
  • WpVote
    Votes 3
  • WpPart
    Parts 7
  • WpHistory
    Time 1h 32m
AttaccHelicopter
Ongoing, First published Oct 12, 2023
actionaction-adventureadventurefantasymagicmysteryromancespinoffsystemvalkyriewitchwitchcraft
In the mysterious and magical world of Vysarria.

A band of Western merchants from the Kingdom of Eyllish journeyed through the infamous 'Silk Road' to reach the land of Zhongning, a powerful eastern kingdom in the eastern continent to gather riches and trade. On their way, they would stumble upon a lost boy who goes by the name, 'Takumi', who suffers from amnesia after his unfortunate arrival on the mainland. 

Along the journey, Takumi would be put to the test as he and his newly found family travelled the vast rural countryside while meeting many interesting people. But slowly, Takumi's dormant skills and hidden talents will begin to resurface, revealing him to be more than just an ordinary boy from nowhere.

**

A spin-off story to @Kiyoshi_1864 'The Valkyrie in Vysarria' which takes place 9 years before the main story. A story which expands on the wonderful mysterious world of Vysarria.
All Rights Reserved
actionaction-adventureadventurefantasymagicmysteryromancespinoffsystemvalkyriewitchwitchcraft
Table of contents

7 parts

Sign up to add Vysarria: The Wanderer to your library and receive updates
or
Content Guidelines
You may also like
The Bounded Kross {Short Story for now} by Primestormy
6 parts Complete Mature
A witch named, Valentia Kross stole a few precious items from a demon named, Storm Bluestone. In the 1600's Valentia's mother was murdered. Many years later, Valentia ran away from the colony. She never aged a day over 35 and never got too serious, watching them grow old. Her wolf pup stops aging at Three. Each time someone notices her not aging. Next minute Valentia would be gone never to be heard of again. A few hundred years later in nineteen ninety-Two got married and had Elisabeth Kross. The father departed out of the picture after six months. Five years have gone by, a thunderstorm was brewing and a ball of fire came crashing down from the sky. Valentia found a strange male lying in a field, claims to be a fallen angel. Hazel Kross was born nine months later. Another Five years past by quickly. Their father disappeared weeks earlier and found died, mysteriously. Thirteen years elapsed, Storm found the Kross family in a small town of Hollowcliff, Minnesota. Hazel Kross is eighteen years old and Elizabeth Kross is twenty-one, now. Storm arrives everything started to be dreadful. Hazel uncovered the truth about her and the family. A revealing she was half angel and half-witch. Storm Bluestone inhabits Hazel's body to open a wormhole inside their town's creek. Thousands of different species of creatures arrive to cause chaos and mayhem. Even the Devil does not know about their existence. Making old and new friends to battle in order to defeat these deadly creatures. Also, save the planet in this new adventure series. I made this book into a short story, after losing it. This is all I was able to recover. I will edit it and change it around. maybe repost all of it. eventually, rewrite the whole book. Vote, comment, or message me if you like the first book of my series. Enjoy my new The bounded Kross series. Show some support if you can. I hope you become a fan of my work, more to come.
Words That Never Reached You [HI3] by Just_Manny
25 parts Ongoing
A What If Timeline from my other Honkai Story in which the Captain dies and reincarnates once again. A young boy with a sword, traveling alone with the skills his teacher taught and passed down to him. In this Apocalyptic-like world, with his memories gone once again, how will things go about when the Valkyries find him once again? "Captain?" Captain...? Who's she talking about? "CAPTAIN!" W-What is this? Why is this pretty lady hugging him? And why is she calling him Captain? Did she mistake him or something? He's no Captain! He's F/N Blair! Also, why are there more girls looking at him with shock? Cover Source: https://honkaiimpact3.hoyoverse.com/m/global/en-us/media/wallpaper
Things We Can't Say by _jnicole_
41 parts Complete
-a THAT'S A GOOD QUESTION spinoff!- Eleven years ago, the Donahue family was torn apart when their father sold out their pack to a group of ravenous werewolf hunters. The oldest, Violet, was sent overseas with her mother to be shown off in circuses and plays, while the youngest, Jamie, was forced into the wolf fighting rings in Atlanta. Though Violet and Jamie are reunited, they are far from patching up the family they once had. Following the events of THAT'S A GOOD QUESTION and SOMETHING I DON'T KNOW, Violet and Jamie set off in search of their estranged mother, worried she--as they were--is suffering and in danger. Their search will carry them across Europe and Asia, earn them new friends and new foes, and demand a new resolve. However, when strange rumors begin to pop up surrounding a mysterious "Ghost Wolf," the brother and sister duo may have to face the fact that their mother is not the woman they once knew. Old friends. New flames. Strange stories. Follow Violet and Jamie's tumultuous journey across the wider world to rescue the woman they know and love.
Rashid: Aries the Warrior (Trials of the Zodiac Book 3) by mmiddle5
20 parts Complete Mature
Rashid once stood as the cosmos' greatest warrior, his reputation a beacon of strength-until a tragedy he could have prevented shattered him. With his heart broken and pride humbled by the loss of his beloved, he retreated from the battlefield to the quiet isolation of a mechanic's life. But when fate calls him back, Rashid is swept into an epic journey alongside Balam, Jalen, and Kai in the Ethereal Plane, a place where the stakes couldn't be higher. Together, they stand against the threat of the Four Horsemen, whose twisted ambitions place them all in unimaginable danger. On the other side of the Ethereal Plane, Qismat-the realm's finest blacksmith-has lived in devoted solitude, wielding his craft with dedication, his heart as steadfast as his hammer. But when a lost love returns to his life, her memories intact, Qismat faces emotions he'd buried long ago. As chaos ripples through the angelic realm, Qismat must rise beyond his self-imposed isolation and prove that even a humble blacksmith can alter the fate of worlds. In a tale where broken warriors and forgotten lovers must confront their pasts, Rashid and Qismat discover that true strength comes not from power alone, but from the courage to face one's deepest wounds. Together, can they redeem their legacies and restore balance to the Ethereal Plane, or will their pasts bind them forever?
The Ashes Wake by jessixawrites
30 parts Complete
When Raiden is told by the Sage Witches he must kidnap Trifica Larkin for the sake of their world he sighs a bit, complains a bit more, but ultimately accepts the task-as he always does. Guilt has a funny way of making him feel obligated. However, this job isn't like all the others and not just because Trifica reminds Raiden of his old love who died centuries ago. This time, the job means all of creaturekind will perish if he fails. It doesn't help that along the way his ring-the sole item capable of keeping him alive-becomes broken, that a shadow wolf war is about to begin, or that their enemy seems to know horrible truths about himself he'd buried so deeply he had nearly forgotten. Trifica, however, finds herself quite pleased to be kidnapped. She's sick of being a Kalied, the second lowest of all species. She wants to flee from her mother's disapproving glare and if she has to travel with Raiden across the Realm as they try to avoid dying, so be it. Except the closer Trifica and Raiden get to the Sage Witches, where safety and answers await them, the more questions and danger they realize lies ahead.
A Pet for the Dragons by annablazer
181 parts Ongoing Mature
❝Three dragons and their naughty little pet.❞ There's a rule in piracy - never fuck with the Dragons because they burn you alive. Literally. I'm not a fan of following rules, especially when the Dragons' hoarding obsession makes them the wealthiest patrons. I shouldn't be surprised when I'm kidnapped by the dragons upon failing to fulfil my end of an important deal. As if my luck couldn't be more of a bitch to me, I get kidnapped by none other than the three Dragons from one of the most powerful clans in the Arctic- Radrox, Ivret and Zorge. Now that they have me, I must pay for my failed deal in cash or kind. But that's not what they seem to be interested in, especially with the dwindling population of dragon ladies and their dangerous obsession with me. Those three dragons are definitely going to burn me but with a different kind of fire. ~ It can be read as a stand-alone book. Themes: slow burn, some BDSM, smut (loads of it), dirty talking, knotting, breeding, reverse harem, romance, kink exploration, action, world-building and a purely character-driven plot with wholesome and humorous moments :) What's not in the book? - Grape. Even though there's a power imbalance between the FL and the MLs, whatever happens between them and her involves consent. No cheating. The MLs don't do each other in this book.
The Modern Countess by AlexiaPraks
87 parts Complete
When life gives you a second chance in a medieval fantasy world, make sure you revolutionize it. Getting hit by a truck wasn't on my post-graduation bucket list. Neither was waking up as Quinn Fairchild, the illegitimate daughter of a cruel lord in a world of magic and monsters. But at least I got some cool magical powers out of the deal, right? Well, sort of. Sure, I can create modern conveniences and heal people, but now I'm being married off to the infamous Earl of Norsewood-a man whose reputation makes hardened warriors tremble. Turns out this supposedly ruthless earl is actually a gorgeous, caring leader desperately trying to save his dying land. Armed with my 21st-century knowledge, a know-it-all magical creation skill, and a determination to build something amazing, I'm turning this medieval fantasy world upside down. One modern convenience at a time. Now if only I could figure out why my hunky husband keeps looking at me like I'm his personal miracle... The Modern Countess Series (formerly Apparently, I'm the Infamous Earl's Legendary Bride) is a fantasy romance series features a vivacious transmigrated heroine determined to revolutionize a medieval-like, war-torn world with her modern knowledge and magical abilities, alongside a hunky warrior-earl husband hell-bent on protecting his land and people while claiming his wife's heart. This series contains: • Slow Burn Romance • Kingdom Building • Magic System • Found Family • Politics & Intrigue • Food & Cooking • Slice of Life Note: A kingdom-building fantasy series follows protagonists as they develop and manage their domain, from humble villages to sprawling empires, while gathering loyal citizens and allies along the way.
The Valkyrie's Hunt - COMPLETE by TwistedMsQuin
15 parts Complete Mature
A Wyrderworld Tale - VERY MATURE CONTENT - COMPLETE - first draft ~~ In a world of mythics, the gods have fallen a long way. The monsters, well, they're just where they've always been. ~~ Luci's prey is a thief, and so much more... She just doesn't know it yet. "A Valkyrie comes to our world to hunt the thief who stole her magical shield, but retrieves a bigger treasure... at a much higher cost than she ever expected to pay." Urban, pan-mythology, fantasy + queer, explicit, erotica with a pansexual main character & a dash of kink. ~~~ Luci is a pansexual Valkyrie on a mission: to catch a thief. Without their stolen shields she is the only one of her Valkyrie sisters who can walk the earth to find them, as long as she has plenty of sex. The cost she knows is one she is more than willing to pay, but the mystery behind the burglary may reveal a price higher than she knew... ~ Valkyrie's Hunt is my first erotic novella. Hope you enjoy. Feedback welcome! If you like it do please follow to get notified of new chapters! ~ Estimated Progress: COMPLETE (first draft) ⚠️ CW: explicit content, casual sex, F/F/F, F/F, F/M & F/NB, LGBTQA+, BDSM, kink, and other mature content. Check top of each chapter for specifics. ⚠️ 🔞 Over 18s only please. 🔞
LuxÆterna by kirisunalyra
19 parts Complete
Spinoff to the story of LosÆterna, which was co-written by LyraLSchild and I. This is however, a separate story (parallel to LyraLSchild's story of NoxÆterna) inspired by my own personal life in the point of view of an original character/creation (OC) I made - Kiri, a werewolf angel girl - who introduces her friend, a butterfly fairy named Lyra, to a new group of unusual people in a guild that she had met only a few weeks ago. This guild ends up affecting both Kiri's and Lyra's life dramatically, though they do not expect it. The happiness they experience and adventures they make creates an undefinable love and friendship that they believe will last for eternity. However, problems soon disrupt the bliss and leaves Kiri making the most difficult of choices, which may lead to her imminent death and the loss of all her friends. Is this Eternal Light truly eternal?
You may also like
Slide 1 of 9
The Bounded Kross {Short Story for now} cover
Words That Never Reached You [HI3] cover
Things We Can't Say cover
Rashid: Aries the Warrior (Trials of the Zodiac Book 3) cover
The Ashes Wake cover
A Pet for the Dragons cover
The Modern Countess cover
The Valkyrie's Hunt - COMPLETE cover
LuxÆterna cover

The Bounded Kross {Short Story for now}

6 parts Complete Mature

A witch named, Valentia Kross stole a few precious items from a demon named, Storm Bluestone. In the 1600's Valentia's mother was murdered. Many years later, Valentia ran away from the colony. She never aged a day over 35 and never got too serious, watching them grow old. Her wolf pup stops aging at Three. Each time someone notices her not aging. Next minute Valentia would be gone never to be heard of again. A few hundred years later in nineteen ninety-Two got married and had Elisabeth Kross. The father departed out of the picture after six months. Five years have gone by, a thunderstorm was brewing and a ball of fire came crashing down from the sky. Valentia found a strange male lying in a field, claims to be a fallen angel. Hazel Kross was born nine months later. Another Five years past by quickly. Their father disappeared weeks earlier and found died, mysteriously. Thirteen years elapsed, Storm found the Kross family in a small town of Hollowcliff, Minnesota. Hazel Kross is eighteen years old and Elizabeth Kross is twenty-one, now. Storm arrives everything started to be dreadful. Hazel uncovered the truth about her and the family. A revealing she was half angel and half-witch. Storm Bluestone inhabits Hazel's body to open a wormhole inside their town's creek. Thousands of different species of creatures arrive to cause chaos and mayhem. Even the Devil does not know about their existence. Making old and new friends to battle in order to defeat these deadly creatures. Also, save the planet in this new adventure series. I made this book into a short story, after losing it. This is all I was able to recover. I will edit it and change it around. maybe repost all of it. eventually, rewrite the whole book. Vote, comment, or message me if you like the first book of my series. Enjoy my new The bounded Kross series. Show some support if you can. I hope you become a fan of my work, more to come.

More details