Love Athena
Thatgurlaturdoor
  • Reads 916
  • Votes 201
  • Parts 22
  • Time 3h 7m
  • Reads 916
  • Votes 201
  • Parts 22
  • Time 3h 7m
Thatgurlaturdoor
Ongoing, First published Oct 16, 2023
archivebookdreamlandbooksfantasyhiddenfeelingsjadeheartcontestnewstoryparanormalpossessiveprinceromanceromancestoriessciencesecretssisterstrongfemaleleadteriyakivampirewarriorswaterwerewolf
Navigating a Treacherous Realm of Science, Royalty, and Unraveling Emotions

An archivist scientist whose existence is a scientific wonder. Well, whatever one can use to explain the phenomenon of mixing science and the paranormal. Camila goes beyond what is expected of her 21-year-old self. A seemingly perfect paranormal physically and mentally with one huge flaw the size of Texas: She had no emotions or so she thought.

A prince who got the throne after his 205-year-old sister denied it. Burdened by his sheltered upbringing of video games, fleeting romances, and the comfort of teriyaki pockets, he must now navigate the treacherous waters of royal duties. 

The unlikely pair collides as a series of threats, initially lurking in the shadows, start to surface. How do they work together when one is still learning to have a heart?

P.S: I do not write smut for any of my characters. If you are looking for that, then this is not the book for you.
All Rights Reserved
archivebookdreamlandbooksfantasyhiddenfeelingsjadeheartcontestnewstoryparanormalpossessiveprinceromanceromancestoriessciencesecretssisterstrongfemaleleadteriyakivampirewarriorswaterwerewolf
Table of contents

22 parts

Sign up to add Love Athena to your library and receive updates
or
#358dreamlandbooks
Content Guidelines
You may also like
The Marriage Game by TenaciousPterodactyl
50 parts Complete
Getting a soulmate sounds like a dream come true. Getting a soulmate who wants to destroy your family? Not quite as romantic. When Camila was five, a man in a clown mask hid under her bed and tried to kidnap her. Fourteen years later, her enemies are deadlier, harder to identify, and--literally--hungry for her blood. From the alphas vying for her hand in marriage to the soulmate eager to use the bond for his own gain to the army of vampires marching closer every day, Camila is a bundle of frayed nerves and duty trapped inside the image of a polished princess. For all she knows, her next enemy could be her last. She needs to step up and do her duty: marrying rich for her kingdom's economy. But taking responsibility could mean giving up her chance at true love, a price that feels steeper as her relationship with her bodyguard deepens and she meets the soulmate she can't help but want. ______________________ Featured by @Werewolf (New Adult Reading List) Featured by @StoriesUndiscovered in January 2022 (Fangs and Fur Reading List) Winner of the Sunflower Awards 4.0
The Raven - Born Out The Earth by milz0923
64 parts Complete
'"I cannot feel this way. You clearly don't feel-" "I do though." He interrupts me. I finally look up to meet his eyes. It holds so much sadness. "Believe it or not but it hurts me every time I see tears in your eyes." His hands reach for my face, one more time and gently wipes the tears off my face. No matter what, the tears keep flowing down. "Please don't cry." He whispers. "You have someone out there just for you. Waiting for you." I whisper softly. A sad smile forms on my face that is now saltier than the ocean bed itself. I try to tug his hand off my face, but his hold is firm. He leans his head down and places it against mine. "I know." His whisper equally soft. "You need to let go. Just as I am." I close my eyes and take in the breeze of ocean that surrounds him and now me. I hear a deep growl just as his hold tighten on my face but it's still gentle.' For the little Raven that was born out the woods, life was only about the survival of fittest. Hunt or be hunted. Until Aya came along and showed her that there was more to life. They became family, sisters and promised to stay together forever. But what happens when one of them finds their mate? Read along to find out the story of Amara Raven on her journey to find a place she belongs. Completed: 12/05/20 Can be read alone!
THE HEART OF SHADOWS by ke_nzie4u
7 parts Ongoing
"Beyond the veil of the mundane, where shadows danced and whispers spoke secrets, a young woman named [Camilie] stumbled upon a hidden path. A path that led her to the threshold of a realm both wondrous and treacherous - the domain of the Demon King. Here, time was a river that flowed in circles, and the very air was alive with ancient power. And [camilie] was about to find herself swept away by a love that would change the course of her destiny forever."
Conquest of Magic by ShruthiAshok9
61 parts Complete Mature
Prologue She leads a simple life and is unaware of her great abilities or the existence of the supernatural world. She finds herself drawn to two charming princes. One is a vampire who loves her more than his mate, and the other is a witch who haunts her dream and claims her to be his mate. What will happen when her life is plunged into danger as ancient prophecies, vampires, werewolves and witches invade her life, and the choice she makes will change her fate? She must choose! Have you ever read a book where a vampire and a witch, both from different realms, are brothers and fall in love with a girl whose powers are superior to both their races? If not, then this book is for you. This is a story about two princes who fight hard for her love, but it seems like neither of them will win her heart, or will they?
My Mother Runs With Wolves by Zoe_Blessing
51 parts Complete
A genetically unique but emotionally lost teenager must figure out who she is within her mixed-up, warring world of Shifters and Wolfstalkers. ***** It wasn't Maddie's choice to be born a half-breed, half Shifter, half Wolfstalker -- a hunter of Shifters -- and it wasn't her choice to keep her identity a secret. But after trying to attend high school like any normal sixteen-year-old, things quickly spiral south when her Stalker uncle finds out about her and catapults her out of anonymity and into the awareness--or possibly the crosshairs--of The Order of the Wolfstalker. Maddie must think fast and figure out a way to keep herself and her family safe, or risk losing everything. Including her life. [[word count: 70,000-80,000 words]]
Royal Wolves [Book 1: Royal Series] by gold-plated
38 parts Complete
[COMPLETED] Arianna has been bullied most of her teen life. Her family are the only reason that she still remains strong. She has a heart of pure gold and she sees the good in everyone. Arianna thought she was just another normal human being. Well besides the whole bullying part. That isn't exactly normal. She knew that part at least, but what she didn't know was that she isn't exactly human either. She is a werewolf. Well, half one anyway. Arianna and her twin sisters 18th birthday is close by, pulling the strings of fate and putting in motion destinies. So add in a bunch of new people, a new set of skin, a particular loving mate and whole heap of royalness, you have Arianna's destiny. And yet, it's only just the beginning. |warning| the book is currently under a bit of editing so be warned of inconsistencies. Cover by: @sofkisses #78 in werewolf (highest) Book 1: Royal Wolves Book 2: Royal Rogue
Mote of Darkness by wowimspecial
28 parts Ongoing
Just one phone call is all it takes to leave one consumed by grief. Her sister. Dead. Six dark months later, something dangerous and not quite human lurks. Brixlee soon finds herself targeted by mysterious creatures she never deemed possible. They threaten the safety of her life and that of those she loves. One seemingly helpful and enigmatic man offers his protection. His motives are questionable, but he promises to help her find the answers she seeks. But can Brixlee trust her instincts that lure her closer to this strange man, and can she battle through her depression to survive what's hunting her? ****************************** "I don't get to have that special moment where I breathe against her skin just to see if she'd shiver. I can't grace her neck with the barest touch of my teasing fingertips. She doesn't trust me enough for any of that. She doesn't even know me. Not yet. For now I'm just the creep lingering in the dark, the only place I'm permitted." For those whom wish to know more about what they are getting themselves into... ✅ Book 1: Done & ready to publish at any moment. (May be revised for edits) ☑️ Book 2: 9/10 of the way done ◻️Book 3: Started!
Would you ever? by Jane_Jergi
25 parts Complete Mature
In a world that knows about the existence of a few supernatural creatures, humans are told to kept alert and stay away. The supernatural were dangerous, secretive and rare. So rare, that for a period of time the humans believed that they'd gone extinct. What happens when a young girl discovers the truth? Camila/ You
Witch Wolf (Camren) Book 1 by own-anchor
30 parts Complete
Preternatural Private Investigator and Paranormal Huntress Camila Cabello is used to working alone. Whenever there's a murder or a mystery to solve that involves the preternatural-she's the witch they call. When she's called in to help the local cops work on a mysterious murder case, she finds herself needing all the help she can get. A bloodthirsty werewolf is loose in the city and on a killing spree. As if her plate weren't full enough, a strange she-wolf seeks Cabello's aid, asking her to help find her missing brother. Camila soon learns that the strange she- wolf serves two masters, and one of those masters has taken quite an interest in her. In a world where vampires have charmed their way into modern society, where werewolves walk the streets with their beasts disguised by human skin, Camila Cabello has a secret of her own to protect. She's one of them. Thank you @SLOTHTATO for the dope cover. I've decided to make one of my favorite book series into a Camren fic. I did not create this book and I take no credit for it, all I did was change the character names and descriptions. By all means buy the original book Witch Wolf my Winter Pennington, the book is amazing and a good one to have.
Changeling (Book 1) Rated R by BlAckRosE7777777
47 parts Complete Mature
Aimee's life takes a frightening turn when she starts seeing ghosts. Born as a powerful vampire-faerie hybrid and switched at birth with a human child, her entire life has been a lie but now the truth is catching up and fast. When her family is kidnapped and she starts being hunted for her powers, Aimee is forced to enlist the help of a mysterious new stranger who unbeknownst to her is secretly one of the hunters. Burdened with a heritage she doesn't want, and a snarky vampire who she can't deny her attraction to, Aimee's life is going up in flames. With the world burning around her, will she be able to protect what matters most to her?
You may also like
Slide 1 of 10
The Marriage Game cover
The Raven - Born Out The Earth cover
THE HEART OF SHADOWS cover
Conquest of Magic cover
My Mother Runs With Wolves cover
Royal Wolves [Book 1: Royal Series] cover
Mote of Darkness cover
Would you ever? cover
Witch Wolf (Camren) Book 1 cover
Changeling (Book 1) Rated R cover

The Marriage Game

50 parts Complete

Getting a soulmate sounds like a dream come true. Getting a soulmate who wants to destroy your family? Not quite as romantic. When Camila was five, a man in a clown mask hid under her bed and tried to kidnap her. Fourteen years later, her enemies are deadlier, harder to identify, and--literally--hungry for her blood. From the alphas vying for her hand in marriage to the soulmate eager to use the bond for his own gain to the army of vampires marching closer every day, Camila is a bundle of frayed nerves and duty trapped inside the image of a polished princess. For all she knows, her next enemy could be her last. She needs to step up and do her duty: marrying rich for her kingdom's economy. But taking responsibility could mean giving up her chance at true love, a price that feels steeper as her relationship with her bodyguard deepens and she meets the soulmate she can't help but want. ______________________ Featured by @Werewolf (New Adult Reading List) Featured by @StoriesUndiscovered in January 2022 (Fangs and Fur Reading List) Winner of the Sunflower Awards 4.0

More details