My Secret Mafia
Farlight27
  • Reads 6
  • Votes 0
  • Parts 2
  • Time 6m
  • Reads 6
  • Votes 0
  • Parts 2
  • Time 6m
Farlight27
Ongoing, First published Nov 02, 2023
animefanfictionfynnimaginationownstorypublishedrandomreadatyourownriskreadpleaseviewerviewfinderviewpoint
It is about a girl who like one of the most handsome, popular and feared boy in Golden High university. One day her bestfriends signed her in a dating app without her knowing and she got partner up with her long time crush, they go on for a few dates not realizing  she is dating a mafia boss and lowkey getting in trouble dating this guy and risking her own life.
Public Domain
animefanfictionfynnimaginationownstorypublishedrandomreadatyourownriskreadpleaseviewerviewfinderviewpoint
Table of contents

2 parts

Sign up to add My Secret Mafia to your library and receive updates
or
#799ownstory
Content Guidelines
You may also like
Tera Deedar Hua 🖤🥀🖤 by SeraphineEmber
55 parts Ongoing
🎶🎶Yun tera muskurana, Aur aake chale jaana Kismat ka hai khul jaana Tera Deedar Hua, Pehla sa pyar hua Pehli hi baar hua iss dil ko Naa toh inqaar hua Naa hi iqraar hua Jaane kya yaar hua iss dil ko🎶🎶 Hello Everyone! This is the fourth Book in Short Story Collection!!!! With new journey, new characters and new affection!
Indian short stories by Narrativenest
62 parts Ongoing
Collection of different Indian short stories.
𝐒𝐢𝐧𝐠𝐥𝐞 𝐝𝐚𝐝 ~ 𝐎𝐧𝐞𝐬𝐡𝐨𝐭𝐬 by 00_mafia_00
22 parts Ongoing
The One-shots revolve around the journey of a devoted single father navigating the complexities of parenthood and his deepening bond with his sons. Each story highlights the unique challenges and heartwarming moments they share, capturing the essence of love, resilience, and the unbreakable ties of family. If you are interested, please check it out. I hope you enjoy it.
👩🏻‍❤️‍👨🏻❤️❤️❤️ (sidnaaz) 🔥🔥🔥🥵🥵🥵 by DishaHarishRajput
123 parts Ongoing
Full mature so Read your own risk
🔞ហឹរ 2+3នាទី🥵🔥 by AgustRed0693
23 parts Ongoing
🗣️: បើមិនចូលចិត្ត ពាក្យពេចន៍មិនសមរម្យឬចំៗ សូមកុំចូលអាន [BL]🔥🔞🥵 Tae X +++ (S+E+X) [17.10.24]
Oneshots by funvfbbgh
14 parts Ongoing
Smutt Fluff Maybe angst this will contain lesbian, gay and straight (if it's straight, the male will not be dominant it's all femdom.) BDSM
The Badass Mafia Queen: The rise of power by lynnmason586
84 parts Complete
Alissa Iris De León the daughter of both the Spanish and Italian Mafia. A week after she was born she was sent away from her 2 brothers to live with her father. Alexandro De León, Alissa's father and the leader of the 1st powerful mafia which is the 'Italian Mafia'. He is the most feared man in the world and is known to never show emotions. They call him the 'THE DEVIL'. You utter a word to him or even make a little mistake he won't hesitate to kill you. After 12 years of living with him she became a copy of him no she became even worse than him. On her 13th birthday she was sent back to live with her mother and brothers. 2yrs of living with them her mother was presumed to be 'dead' and they were sent to live with their uncles who were surprise surprise the leaders of the American Mafia.
WOSO Oneshot by woso_wosolover
200 parts Complete
A WOSO Oneshot book Oneshots of favourite Women's footballers Mainly the Lionesses, Arsenal Women's team,Chelsea Women's team, Man City Women's team and Man Utd Women's team
🍰Fruit Cake 🍰 by shyanne22637
37 parts Ongoing
Sxs Oneshots 🤪
No Going Back by AgaciaR
16 parts Ongoing
𝘙𝘢𝘯𝘥𝘰𝘮 𝘙𝘦𝘢𝘭𝘪𝘵𝘪𝘦𝘴 Book 3 Unforgivable Series #2 Where should your husband be when you're having a difficult, risky pregnancy? Right by your side! Where was he though? With his childhood best friend and business partner, partying, kissing and making out or worse. All marriages have ups and downs, but once you take a one-way route of cheating, there is No Going Back.
You may also like
Slide 1 of 10
Tera Deedar Hua 🖤🥀🖤 cover
Indian short stories cover
𝐒𝐢𝐧𝐠𝐥𝐞 𝐝𝐚𝐝 ~ 𝐎𝐧𝐞𝐬𝐡𝐨𝐭𝐬 cover
👩🏻‍❤️‍👨🏻❤️❤️❤️ (sidnaaz) 🔥🔥🔥🥵🥵🥵 cover
🔞ហឹរ 2+3នាទី🥵🔥 cover
Oneshots cover
The Badass Mafia Queen: The rise of power cover
WOSO Oneshot cover
🍰Fruit Cake 🍰 cover
No Going Back cover

Tera Deedar Hua 🖤🥀🖤

55 parts Ongoing

🎶🎶Yun tera muskurana, Aur aake chale jaana Kismat ka hai khul jaana Tera Deedar Hua, Pehla sa pyar hua Pehli hi baar hua iss dil ko Naa toh inqaar hua Naa hi iqraar hua Jaane kya yaar hua iss dil ko🎶🎶 Hello Everyone! This is the fourth Book in Short Story Collection!!!! With new journey, new characters and new affection!

More details