Love, Blood and Wilderness | YELLOWJACKETS
wandamaximilfff
  • Reads 83,155
  • Votes 3,508
  • Parts 57
  • Time 11h 54m
  • Reads 83,155
  • Votes 3,508
  • Parts 57
  • Time 11h 54m
wandamaximilfff
Ongoing, First published Nov 29, 2023
Mature
3 new parts
benscottcourtneyeatonellapurnellfanfictionjackietaylorjasminesavoybrownlauraleelesbianromancelivhewsonlottiematthewslottiematthewsxocmistyquigleynataliescatorrcionataliescatorrcioxocoriginalcharactershaunashipmanshaunashipmanxocsophienelissesophiethatchertaissaturnerthewildernessvanpalmerwlwyellowjacketsyellowjacketsfanfic
Though the wilderness is dangerous and death seems scary, love just might be the worst of them all.

yellowjackets season 1-?
lottie matthews x fem oc
natalie scatorrcio x fem oc
shauna shipman x fem oc
@wandamaximilfff


story for if you love characters who made horrible decisions and and love squares
Public Domain
benscottcourtneyeatonellapurnellfanfictionjackietaylorjasminesavoybrownlauraleelesbianromancelivhewsonlottiematthewslottiematthewsxocmistyquigleynataliescatorrcionataliescatorrcioxocoriginalcharactershaunashipmanshaunashipmanxocsophienelissesophiethatchertaissaturnerthewildernessvanpalmerwlwyellowjacketsyellowjacketsfanfic
Table of contents

57 parts

Sign up to add Love, Blood and Wilderness | YELLOWJACKETS to your library and receive updates
or
Content Guidelines
You may also like
π“π‘πž 𝐅𝐒𝐫𝐬𝐭 π“πšπ¬π­πž π–¦Ή 𝐘𝐞π₯π₯π¨π°π‰πšπœπ€πžπ­π¬ by -freezerbride
7 parts Ongoing Mature
" 𝐋𝐄𝐓 πˆπ“ ππ„π†πˆπ, 𝐇𝐄𝐀𝐕𝐄𝐍 π‚π€πππŽπ“ π–π€πˆπ“ π…πŽπ‘π„π•π„π‘ ! " In which, during her freshman year, Kennedy Scatorccio bumped into Lottie Matthews in the hallway and instantly developed a crush on the girl. Determined to get closer to Lottie, she made it her mission to join the girls' soccer team her sophomore year. Who knew her crush on the lonely rich girl would lead her stranded in the Canadian wilderness? (lottie matthews x fem!oc)
SONDER | yellowjackets by ilyieuwdm
43 parts Ongoing Mature
"I can't keep pretending. I love you, more than I've ever loved anyone. And it terrifies me, but it's the truth. I need you to know." [yellowjackets s1-] [shauna shipman x oc] [lottie matthews x oc] [natalie scatorccio x oc]
Just Like Heaven (lottienat) by sapphiclesbain22
10 parts Complete Mature
Lottie Matthews and natalie scatorccio realise soon sought that they have a little too much in common then they thought they had they make plans to 'live their lives' free from everything
Nightmares -Yellowjackets by -LadyKidd-
43 parts Ongoing Mature
In 1996, a high school girls' soccer team flies to Seattle for a national tournament. However, the plane crashes in Ontario, and the survivors are left to fend for themselves for nineteen months. fem oc 𝒙 Natalie Scatorccio [yellowjackets: s1- ] {English is not my first language, I apologize for any grammatical errors}
Getaway Car, Yellowjackets - ON HOLD - by sqattorodicos
16 parts Ongoing Mature
GETAWAY CAR- You were drivin' the getaway car We were flyin', but we'd never get far Don't pretend it's such a mystery Think about the place where you first met me Josette Taylor had a good life. key word was, had. Now she had to cover up every horrible thing she did that she wasn't pround of. 2023, april 18th. lottie Matthews x fem!oc + Jackie Taylor x fem!oc yellowjackets β™±
CHERRY BOMB ~ yellow jackets (van palmer) by ginnyoxox
31 parts Ongoing Mature
thanatophobia ~ the fear of losing someone you love. cheryl stevens COULD have been a champion, aswell as the other girls on on her team she had a future. that all changed in the summer of '96. the girls soccer team was set to go to nationals, in just a few hours that all changed.. ----------- van palmer x fem!oc πŸ‘©β€β€οΈβ€πŸ’‹β€πŸ‘© i do not in anyway own yellow jackets or it's characters Cheryl steven's is an original creation of mine so is her storyline! created: wednesday 3rd april 2024 ended: ?? no.4 in #vanpalmer no.22 in #wilderness
Exanimate by missperegrinesfav
5 parts Ongoing Mature
showing no sign of life; lifeless.
starstruck | natalie scatorccio by fruitcombo
9 parts Ongoing Mature
bonnie didn't hold much faith, she didn't know where faith came from. the crash changed that, made her better. ──────────────────── yellowjackets s1 : coming soon yellowjackets s2 : coming slow updates natalie scatorccio x oc
STRANGERS β™± yellowjackets by adelinethevampire
52 parts Ongoing
AM I MAKING YOU FEEL SICK ? Susann-Rose Hopper hated Natalie for stealing her brother away from her. To Natalie Scatorccio, Susann-Rose "Bunny" was only her best friend's perfect, angelic, over-achieving, and slightly neurotic twin sister who drove her insane. The bittersweet hatred and love the two carry for each other suddenly becomes the only familiar thing in the strange heart of the wilderness. Natalie Scatorccio x fem oc Yellowjackets season 1-2 1# Natalie Scatorccio 1# Yellowjackets 1# Lottie Matthews 2# Showtime 1# Ethel Cain
𝐀𝐅𝐓𝐄𝐑 πƒπ€π‘πŠ β˜… yellowjackets by love-quinn
14 parts Ongoing Mature
𝐀𝐅𝐓𝐄𝐑 πƒπ€π‘πŠ. β€Ž β€Ž β€Ž β€Ž β€Ž β€Žβ‚‚β‚€β‚‚β‚„ β€Ž β€Ž β€Ž β€Ž β€Ž β€ŽΒ©love-quinn ❝wait for the signal and i'll meet you after dark.❞ in which lorraine and her soccer team crash land in the wilderness on the way to nationals lottie matthews x fem!oc completed 00.00.00 total words 000 yellowjackets s1 + 2
You may also like
Slide 1 of 10
π“π‘πž 𝐅𝐒𝐫𝐬𝐭 π“πšπ¬π­πž π–¦Ή 𝐘𝐞π₯π₯π¨π°π‰πšπœπ€πžπ­π¬ cover
SONDER | yellowjackets cover
Just Like Heaven (lottienat) cover
Nightmares -Yellowjackets cover
Getaway Car, Yellowjackets - ON HOLD - cover
CHERRY BOMB ~ yellow jackets (van palmer) cover
Exanimate cover
starstruck | natalie scatorccio cover
STRANGERS β™± yellowjackets cover
𝐀𝐅𝐓𝐄𝐑 πƒπ€π‘πŠ β˜… yellowjackets cover

π“π‘πž 𝐅𝐒𝐫𝐬𝐭 π“πšπ¬π­πž π–¦Ή 𝐘𝐞π₯π₯π¨π°π‰πšπœπ€πžπ­π¬

7 parts Ongoing Mature

" 𝐋𝐄𝐓 πˆπ“ ππ„π†πˆπ, 𝐇𝐄𝐀𝐕𝐄𝐍 π‚π€πππŽπ“ π–π€πˆπ“ π…πŽπ‘π„π•π„π‘ ! " In which, during her freshman year, Kennedy Scatorccio bumped into Lottie Matthews in the hallway and instantly developed a crush on the girl. Determined to get closer to Lottie, she made it her mission to join the girls' soccer team her sophomore year. Who knew her crush on the lonely rich girl would lead her stranded in the Canadian wilderness? (lottie matthews x fem!oc)

More details