Middle School: The Worst Days Of My Life
BlissSmith8
  • Reads 3
  • Votes 0
  • Parts 2
  • Time <5 mins
  • Reads 3
  • Votes 0
  • Parts 2
  • Time <5 mins
BlissSmith8
Ongoing, First published Dec 09, 2023
20017thgradealieninvasionbacktoschoolbigfamilybiologyboybandcelebritycomedianfairytalegossiphealthheartthrobhotelmiddleschoolnaturedocumentarynewspapernewyorkparisfrancespacetravelteendrama
In August of 2001, Joslin Smith-Simpson is a 12-year-old girl who attends East Side Middle School and lives with her big family in New York City. However, the Smith-Simpson family felt that their apartment in the Bronx was too small for their guests to live in, so they decided to move to a hotel to start a B&B  business. One day, Joslin's family announced that they were expanding the hotel for a new bedroom for a new resident; a 17-year-old white blood cell named Osmosis Jones, who is on the verge of turning 18. Along the way, the two meet 6 other teenagers, Hector Cruz, Maria Amino, Christine Kolchuck, Leah Estrogen, Paul Spryman, and Drix Koldreliff, and together, the 9 kids get into several antics and chaos.
Public Domain
20017thgradealieninvasionbacktoschoolbigfamilybiologyboybandcelebritycomedianfairytalegossiphealthheartthrobhotelmiddleschoolnaturedocumentarynewspapernewyorkparisfrancespacetravelteendrama
Table of contents

2 parts

Sign up to add Middle School: The Worst Days Of My Life to your library and receive updates
or
#807thgrade
Content Guidelines
You may also like
My Lovely Life by shiraka143
31 parts Ongoing
Alessandra Bianchi , A pure innocent girl merely 16 years , who has never been given a chance to step out in the real world is gonna face a drastic change in her life ..... 12 years ago a the Italian mafia's " princess " was snatched away from the arms of her family.... Alessandra who knows nothing other than abuse and rules given to her by her step-parents whom she calls "sir" and "ma'am". She always imagined having a loving family - a loving father, caring mother and protective brothers ... Never getting an opportunity to step in the outer world aurora is unknown to things every human knows about .... she's a innocent girl who has always watched the outer world through windows and sounds what will happen when one day the capo of the Italian mafia bursts through the doors of aurora's house to take revenge from the "drug dealers " aka her step-parents... Will the universe unite the broken brothers to their missing mafia Princess ?? Will Aurora will be able to cop up with the busy and crazy while complex world ??? #1 mafiaprincess : 2 Dec 2024 #1 babied : 2 Dec 2024 #1 innocent : 2 Dec 2024 #1 scared : 6 Dec 2024 #1 italianmafia : 6 Dec 2024 #1 longlostsister : 6 Dec 2024 #1 longlostsibilings : 6 Dec 2024 #1 italian : 18 Dec 2024 #1 mafiabrothers : 18 Dec 2024 #1 abused : 18 Dec 2024 #1 in Top 10 in India πŸ₯ΉπŸ’—πŸ”₯ -2 Dec 2024 -3 Dec 2024 -4 Dec 2024 -6 Dec 2024
after they met her by peachynamjooni
70 parts Ongoing
|ongoing| Ivana grew up alone. She was alone since the day she was born and she was sure she would also die alone. Without anyone by her side she struggled to make a living, till one day two men stood infront of her door, claiming to be her brothers. Getting to meet her overwhelmed father, her overprotective older brothers and the obsessed man from the rival mafia, Ivana didn't know how to feel nor act anymore. Experiencing love and care for the first time, the feeling of finally belonging isn't the only thing Ivana will have to get used to.
wlw oneshots πŸ’‹ by whosm0rgan
71 parts Ongoing
lesbian oneshots !! includes smut and fluff, chapters near the beginning are AWFUL. enjoy!
My Sugar Daddy by Eva_blossom_16
19 parts Ongoing
π‘‡β„Žπ‘–π‘  π‘Žπ‘›π‘œπ‘›π‘¦π‘šπ‘œπ‘’π‘  𝑀𝑒𝑏𝑠𝑖𝑑𝑒 𝑀𝑖𝑙𝑙 𝑔𝑖𝑣𝑒 π‘¦π‘œπ‘’ π‘šπ‘œπ‘›π‘’π‘¦. π΄π‘Ÿπ‘’ π‘¦π‘œπ‘’ π‘–π‘›π‘‘π‘’π‘Ÿπ‘’π‘ π‘‘π‘’π‘‘ 𝑖𝑛 π‘‘β„Žπ‘–π‘ ? π»π‘Žπ‘£π‘–π‘›π‘” π‘Ž π‘ π‘’π‘”π‘Žπ‘Ÿ π‘‘π‘Žπ‘‘π‘‘π‘¦, 𝑒𝑣𝑒𝑛 π‘‘β„Žπ‘œπ‘’π‘”β„Ž π‘¦π‘œπ‘’ π‘Žπ‘Ÿπ‘’ π‘Ž π‘‘π‘’π‘’π‘›π‘Žπ‘”π‘’π‘Ÿ. π‘†π‘œπ‘šπ‘’ π‘π‘’π‘œπ‘π‘™π‘’ π‘Žπ‘Ÿπ‘’ 𝑛𝑖𝑐𝑒 π‘œπ‘› π‘‘β„Žπ‘–π‘  π‘’π‘Žπ‘Ÿπ‘‘β„Ž π‘Žπ‘›π‘‘ π‘‘π‘œπ‘›'𝑑 π‘‘π‘Žπ‘˜π‘’ π‘Žπ‘‘π‘£π‘Žπ‘›π‘‘π‘Žπ‘”π‘’ π‘œπ‘“ π‘π‘’π‘œπ‘π‘™π‘’, π‘‘β„Žπ‘œπ‘ π‘’ π‘˜π‘–π‘›π‘‘ π‘œπ‘“ π‘π‘’π‘œπ‘π‘™π‘’ π‘ β„Žπ‘œπ‘’π‘™π‘‘ 𝑏𝑒 π‘˜π‘’π‘π‘‘ 𝑖𝑛 π‘œπ‘’π‘Ÿ 𝑙𝑖𝑣𝑒𝑠. π‘ π‘’π‘”π‘Žπ‘Ÿπ‘‘π‘Žπ‘‘π‘‘π‘–π‘’π‘ .π‘π‘œπ‘š βƒβƒπ“π‘πŽππ„π’βƒβƒ β€’π™°πšπšŽ-πšπšŠπš™ β€’π™Άπš›πšžπš–πš™πš’Γ—πšœπšžπš—πšœπš‘πš’πš—πšŽ β€’π™±πš’πš•πš•πš’πš˜πš—πš’πšŠπš›πšŽ πš›πš˜πš–πšŠπš—πšŒπšŽ β€’π™΅πš˜πš›πš‹πš’πšπšπšŽπš— πš›πš˜πš–πšŠπš—πšŒπšŽ β€’ π™Ύπš•πšπšŽπš› πš–πšŽπš—
Their Long Lost Prince by T_M_K_T_R_5
23 parts Ongoing
Lorenzo was kidnapped from his family at the early age of three He has went through hell and back and still came out strong. He lives his life with one rule;Don't love because it only gets you hurt And he has followed this rule okay,with only having one best friend/brother But he's rule got in trouble the day he found out he's foster parents are dead and he has a family Is he gonna break he's rule for them? Is he gonna trust them? Is he gonna let them in? See what happens in Lorenzo's story if you add humour, betrayal,secrets and he's brothers handsome best friend who he's hell bent on hating. Read to find out...
MIRACLE (βœ”οΈ) by Clifoconda_HemHem
55 parts Complete
"My mother named me Miracle, but I am anything but a miracle in her and our family's life. I am a mistake. I am a product of a heinous crime." Miracle Astor was born after the rape of her mother. Aurora Astor was convinced by everyone in her family to have an abortion when she found out that her assault had resulted in a child, but much to everyone's shock Aurora kept the child and after a long and excruciating labor on her last breath she gave her daughter the name Miracle. After Aurora died giving birth to her daughter, little Miracle was left under the care of her brothers all of whom blamed her for the tragedy that happened to their mother. But in order to protect the reputation of their late mother and their well-known family name, the Astor brothers raised Miracle as their own and made the public believe that she was the full-blood daughter of the Astor family. Sixteen years later, Miracle became depressed and neglected as she carries the heavy weight of pain, guilt, and blame for what happened to her mother. But what happens when history tries to repeat itself with what happened to Aurora now to Miracle? And the terrible secret of their family cracks and reveals itself out to everyone? Will Miracle finally break? Will her brothers finally step in and be the brothers that she needed? Will someone stop the history from repeating itself and finally save Miracle? Read to find out!
𝐌𝐫. π‰πžπ¨π§'𝐬 𝐒𝐩𝐨𝐒π₯𝐞𝐝 𝐁𝐫𝐚𝐭 || πŠπ¨π¨π€π‰π’π§ 𝐅𝐅 by Ilmoonbit
57 parts Ongoing
"I hate you!" "You're allowed to hate me but you aren't allowed to do the things I β„Žπ‘Žπ‘‘π‘’, π‘‘π‘Žπ‘Ÿπ‘™π‘–π‘›π‘”." Where Kim Seok Jin had to marry the world's youngest billionaire, unwillingly. The man is everything Jin hates in a person. He is obsessive, overprotective, very controlling and always wants things on his way. Well, Jin being a arrogant and short tempered guy, stick to his ground, He had one mission - Avenge his best friend and turn this man's life a hell, But what Jin couldn't guess was that his unwanted and enemy husband was more than he thought...more than he showed... *** Main couple : Jinkook/Kookjinβœ… Side couples : Sopeβœ… Vminβœ… Tropes : Traumaβœ… Obsessionβœ… Forced marriageβœ… Romanceβœ… Comedyβœ… Green flagβœ… Annoying bottomβœ… Happy endingβœ…
The Flynn Effect by -olliee
61 parts Complete
Josephine Pryce will do anything to get out of Lakeville even if it means simply tutoring her arch-nemesis Flynn Cauley. Except when it comes to him, things aren't always simple. *** Jo and Flynn couldn't be any more different than they already are. She's an uptight, type 1 diabetic and captain of the debate club and he's a notorious womanizer with a devil-may-care attitude and seemingly nothing to worry about. But now he needs help with English and she needs money for college. So regardless of the existent feud between them, she accepts to be his tutor in her school's online peer-tutorship program. But things aren't that straightforward when it comes to him. A misconception and desperation later, they decide to become a fake unlikely couple, solely because Flynn needs to make his crush jealous and Jo needs her ex to understand that it's over. Besides, she's partly in love with the hot, gentlemanly school paper president and the only way he'll notice her, is if she somehow becomes popular. Everything will be fine as long as they follow the rules. But then again, rules are meant to be broken. Most impressive rankings; #1 in lovestory #1 in enemies #1 in angst #1 in chronic illness #1 in fake dating #1 in diabetes #1 in YA #2 in heart touching #3 in love hate #3 in enemies to lovers #6 in high school #9 in teen romance #14 in humor #102 in romance
I'm a Costello by _crazy_hooman_
62 parts Complete
β€’[COMPLETED]β€’ Book-1 of Costello series. Valentina is a free spirited bubbly girl who can sometimes be very annoyingly kind and sometimes just.. annoying. She has lived in Texas as long as she can remember with her mother with no knowledge of her rest of her family. Suddenly her life takes a huge turn. Loved ones are lost and sudden revelations are made. She is not very good at dealing with changes. Well let's just say she is in for a huge surprise when she finds out about her father and the fact that she has six brothers. Yeah that's gonna be fun :) . . Yup this is another older brother/ mafia family story. Enjoy! Best rankings: #1 in siblings #1 in Big brothers #1 in American mafia #1 in Costello #1 in cousin #1 in lost Princess #2 in mafia brothers #2 in lost daughter #3 in badass #3 in family secrets #4 in older brother #5 in sarcasm #4 in sister #4 in reunited
Ιͺ ᴋɴᴏᴑ ʏᴏᴜ | ᴍΙͺΙ’α΄œα΄‡ΚŸ α΄…Ιͺα΄€α΄’ by miguelschamp
95 parts Ongoing
"Ιͺ'ʟʟ ǫᴜΙͺᴇᴛ ᴅᴏᴑɴ Ιͺꜰ Ιͺα΄›'s α΄‘Κœα΄€α΄› ʏᴏᴜ α΄‘α΄€Ι΄α΄›. Ιͺ α΄œΙ΄α΄…α΄‡Κ€sα΄›α΄€Ι΄α΄… Ιͺ'ᴍ ɴᴏᴛ α΄›Κœα΄‡ ᴏɴʟʏ ᴏɴᴇ κœ°α΄Κ€ ʏᴏᴜ." [sᴇᴀsᴏɴ 1 - sᴇᴀsᴏɴ 6] κœ°α΄‡α΄!ᴏᴄ x ᴍΙͺΙ’α΄œα΄‡ΚŸ α΄…Ιͺα΄€α΄’ κœ°α΄‡α΄!ᴏᴄ x α΄‡ΚŸΙͺ ᴍᴏsᴋᴏᴑΙͺα΄›α΄’
You may also like
Slide 1 of 10
My Lovely Life cover
after they met her cover
wlw oneshots πŸ’‹ cover
My Sugar Daddy cover
Their Long Lost Prince cover
MIRACLE (βœ”οΈ) cover
𝐌𝐫. π‰πžπ¨π§'𝐬 𝐒𝐩𝐨𝐒π₯𝐞𝐝 𝐁𝐫𝐚𝐭 || πŠπ¨π¨π€π‰π’π§ 𝐅𝐅 cover
The Flynn Effect cover
I'm a Costello cover
Ιͺ ᴋɴᴏᴑ ʏᴏᴜ | ᴍΙͺΙ’α΄œα΄‡ΚŸ α΄…Ιͺα΄€α΄’ cover

My Lovely Life

31 parts Ongoing

Alessandra Bianchi , A pure innocent girl merely 16 years , who has never been given a chance to step out in the real world is gonna face a drastic change in her life ..... 12 years ago a the Italian mafia's " princess " was snatched away from the arms of her family.... Alessandra who knows nothing other than abuse and rules given to her by her step-parents whom she calls "sir" and "ma'am". She always imagined having a loving family - a loving father, caring mother and protective brothers ... Never getting an opportunity to step in the outer world aurora is unknown to things every human knows about .... she's a innocent girl who has always watched the outer world through windows and sounds what will happen when one day the capo of the Italian mafia bursts through the doors of aurora's house to take revenge from the "drug dealers " aka her step-parents... Will the universe unite the broken brothers to their missing mafia Princess ?? Will Aurora will be able to cop up with the busy and crazy while complex world ??? #1 mafiaprincess : 2 Dec 2024 #1 babied : 2 Dec 2024 #1 innocent : 2 Dec 2024 #1 scared : 6 Dec 2024 #1 italianmafia : 6 Dec 2024 #1 longlostsister : 6 Dec 2024 #1 longlostsibilings : 6 Dec 2024 #1 italian : 18 Dec 2024 #1 mafiabrothers : 18 Dec 2024 #1 abused : 18 Dec 2024 #1 in Top 10 in India πŸ₯ΉπŸ’—πŸ”₯ -2 Dec 2024 -3 Dec 2024 -4 Dec 2024 -6 Dec 2024

More details