KALJEND
deffaa_
  • Reads 384,218
  • Votes 13,737
  • Parts 35
  • Reads 384,218
  • Votes 13,737
  • Parts 35
deffaa_
Ongoing, First published Dec 18, 2023
1 new part
acakanaksekolahanaksmaantagonisbadboybadgirlchicklitdarkromancedunianovelfantasifantasyfiksifiksiremajafiksiumumgadisgilagadisnakalnakalnovelremajasekolahtransmigrasitransmigrationwatpadwattpad2024
Nakala Sunyi Semesta

Setelah tragedi di rel kereta api malam itu Kala di buat heran dengan hal aneh yang terjadi pada nya, kala pikir malam itu dia mati tapi Kala malah tertimpa kesialan yang sangat di luar akal manusia yaitu terbangun di tubuh orang lain. Gadis gila itu masuk ke tubuh perempuan lemah dan bodoh

Belum lagi kala harus terjebak dengan Jendral Sharga cowo mesum dan kasar yang sial nya mampu membuat jantung Kala berdetak dua kali lebih cepat.


18+

---
All Rights Reserved
acakanaksekolahanaksmaantagonisbadboybadgirlchicklitdarkromancedunianovelfantasifantasyfiksifiksiremajafiksiumumgadisgilagadisnakalnakalnovelremajasekolahtransmigrasitransmigrationwatpadwattpad2024
Table of contents

35 parts

Sign up to add KALJEND to your library and receive updates
or
#49watpad
Content Guidelines
You may also like
The Alpha King's Mate by Bookdragon2022
32 parts Complete
"Y-your H-highness? I-i'm sorry b-but t-there m-must b-be a-a m-mistake..." A loud growl sounded through the whole ballroom causing me to start shaking and a whimper to escape my lips. This caused the King to stop growling. He pulled me to his chest and yelled out to the whole ballroom. "MINE!" Audrey is an Omega in the Rapid River Pack. Lucas is the Alpha King, Ruling over all and his own pack, The Moonlight Eclipse Pack. Audrey is beaten daily loosing all hope of every meeting her mate. Lucas just wants his mate but feels like she doesn't exist. What happens when the two meet at the Annual Lunar Eclipse Ball? Credits to @M_Rainberry for the amazingly wonderful cover!!!
Pengumuman! by null
Ongoing
LEANDRO (untuk Nara) NEW VERSION by silessly
44 parts Ongoing
"NARA CUMAN PUNYA GUE ANJING!" Sentak Bara. "BACOT BANGSAT!" Mereka tetap saling pukul satu sama lain, wajah mereka juga sudah babak belur, hingga pelukan seorang gadis di salah satu punggung mereka, membuat jeda di antaranya, "Bara, udah Bara. Stop!" ucapnya getir dengan air mata yang deras menetes. Bara, sosok yang di peluk oleh Nara masih menetralkan nafasnya, hidunganya berdarah, bibirnya sudah pecah, mata dan pipinya sudah tidak pada bentuknya, "Aku mohon, stop yah, aku gabisa ... liat Lean kayak gitu," ucapnya sesenggukan. Ada tombak yang menusuk hati Bara, ia pikir Nara memeluknya karna ia telah memilihnya, namun salah. Nara tetap pada Lean nya. Bara membuang nafas besar, menghempas tangan mungil Nara kuat, berbalik badan dan berkata, "Gue ga akan biarin lo sama dia bahagia Nara!" bentak nya kuat. Mampukah Lean memenangkan hati Nara? Atau malah Bara yang berhasil merebut kembali Nara ke dalam pelukannya? ⚠️ Mengandung bahasa kasar ⚠️ Tidak disarankan untuk usia 15- ⚠️ Alurnya ruwet ⚠️ Author nya malesan ⚠️ Update nya kalo mood ⚠️ Dilarang emosi sama Author Dah gitu aja makasih :)
The Exiled Alpha | ✓ by Silverless
37 parts Complete
"It's like he's a different breed of werewolf. Something... beyond us." • • • Adrienne Gage has spent her entire life being shunned and punished for her mouthy attitude, and being loyal to a pack which doesn't deserve her loyalty. It's been a year since her last punishment, and she's been walking on eggshells to keep herself in the clear. But now, that's all being threatened to be taken away if she doesn't abide by what the Alpha's son wants; and that's her as his Luna. At the same time, terrified whispers are circulating around. Mentions of a tyrant Alpha looking for a new pack to conquer. Adrienne thinks nothing of everyone else's paranoia. That is until she finds herself half conscious and being dragged away deeper into the woods with canines around her neck. Highest Ranking #1 in Paranormal Highest Ranking #1 in Werewolf Highest Ranking #1 in Romance Cover made by @Silverless COMPLETED
MISTRESS OF FLAME by CeCeLib
82 parts Complete
[ BOOK 1 OF AZITERA: YTHER'S QUEEN ] Consumed by avarice, the four human kingdoms-the Infernal Empire, the Kingdom of Caelum, the Kingdom of Treterra, and the Nayale Archipelago-betrayed their covenant with Yther of Azitera, the race blessed by deities, who protected humans for untold centuries. They slaughtered and defiled the beings that once protected them from storm, famine, poverty, and pestilence without mercy. Betrayed by the humans they protected, the Ytherians were enslaved. Their four queens were caged, chained, and imprisoned to serve as nutrients to the human kingdoms. The once prominent Ytherians were reduced to nothing but servants. As the four kingdoms of the human race prospered for many years since their betrayal, one news staggered them, causing them to tremble in fear and rally their armies to protect and defend their domain: Sollel-the Mistress of Flame, one of Yther's queens-had escaped her prison. Her flames will raze hell, ready to burn the souls of her betrayers. COMPLETED CECELIB | C.C. COVER: ASTRID JAYDEE
ALDEN by bxrnadette
31 parts Ongoing
Alden Joshua Gracio. The Leader of Dankevoort ‒Geng yang dinyatakan sebagai geng paling berbahaya dan paling dihindari. Pria dengan sejuta rahasia yang sangat terkenal dengan ketampanannya, kepintarannya, kebengisannya, dan tidak pernah terkalahkan. Pria yang sudah datang tanpa permisi, memorak-porandakan kehidupan sempurna milik seorang Aretha Nathania Elaine. Pria yang berhasil membawa warna baru ke kehidupan Aretha Nathania Elaine, mengisi kekosongan satu sama lain di waktu yang tepat. "𝙏𝙝𝙚𝙧𝙚'𝙨 𝙨𝙤𝙢𝙚𝙩𝙝𝙞𝙣𝙜 𝙖𝙗𝙤𝙪𝙩 𝙝𝙚𝙧 𝙩𝙝𝙖𝙩 𝙢𝙖𝙠𝙚𝙨 𝙢𝙚 𝙬𝙖𝙣𝙩 𝙩𝙤 𝙥𝙧𝙤𝙩𝙚𝙘𝙩 𝙝𝙚𝙧 𝙢𝙤𝙧𝙚 & 𝙢𝙤𝙧𝙚 𝙚𝙫𝙚𝙧𝙮 𝙙𝙖𝙮." ―♚☠♛― Start : 16 July 2021 Happy Reading! ♡
Retakan Delusi by mindoyverse
4 parts Ongoing
Bagi Ethan, Zora adalah segalanya. Meskipun selalu berakhir melihat Zora mencintai orang lain, ia tetap setia menjaga gadis itu di sampingnya. Ethan tidak pernah berani mengungkapkan perasaannya karena takut Zora terluka saat mengetahui sahabat yang selama ini ia percaya ternyata memiliki perasaan lebih terhadapnya. Ethan tidak ingin merusak pertemanan mereka yang sudah bertahun-tahun. "Selama ini gue rela ngerasain sakit karena tau lo mencintai orang lain, gue bisa ikhlas asalkan selalu liat lo bahagia. Tapi maaf, kayaknya kali ini gue ga bisa lakuin hal yang sama lagi ke si brengsek itu!" Entah mengapa kali ini berbeda, Ethan tidak ingin lagi melihat gadis itu dimiliki oleh pria lain. Ethan menginginkan Zora hanya menjadi miliknya seorang.
Princess Of The Blazing Fire | ENG | (In The Process Of Being Remake) by valloyard11
13 parts Ongoing
She transmigrated into a new world at an unexpected moment. Became a character that never even mentioned in the story. And live a life so differently from the main character. Bellatrix de Alger Obelia. A princess born to Emperor Claude de Alger Obelia and a female traveler who was a fire elementalist. ••• "Bellatrix, huh? Do you know the meaning of the name your mother gave you?" "The name my mother gave me means 'The Female Warrior'. She wish for I to grow up to be a strong fighter and not easily give up on anything." "And will you be able to live up to the expectations your mother placed in your name?" "The child before you right now is a child who managed to survive multiple assassination attempts solely by her own strength, Your Majesty. Wouldn't that be enough for a starter to meet the expectations my mother placed and eventually yours as well?" ••• Here, the story of Bellatrix de Alger Obelia will begin.
You may also like
Slide 1 of 7
The Alpha King's Mate cover
LEANDRO (untuk Nara) NEW VERSION cover
The Exiled Alpha | ✓ cover
MISTRESS OF FLAME cover
ALDEN cover
Retakan Delusi cover
Princess Of The Blazing Fire | ENG | (In The Process Of Being Remake) cover

The Alpha King's Mate

32 parts Complete

"Y-your H-highness? I-i'm sorry b-but t-there m-must b-be a-a m-mistake..." A loud growl sounded through the whole ballroom causing me to start shaking and a whimper to escape my lips. This caused the King to stop growling. He pulled me to his chest and yelled out to the whole ballroom. "MINE!" Audrey is an Omega in the Rapid River Pack. Lucas is the Alpha King, Ruling over all and his own pack, The Moonlight Eclipse Pack. Audrey is beaten daily loosing all hope of every meeting her mate. Lucas just wants his mate but feels like she doesn't exist. What happens when the two meet at the Annual Lunar Eclipse Ball? Credits to @M_Rainberry for the amazingly wonderful cover!!!

More details