Beta Squad! (BxB)
bettingbetas
  • Reads 51,721
  • Votes 776
  • Parts 75
  • Time 5h 8m
  • Reads 51,721
  • Votes 776
  • Parts 75
  • Time 5h 8m
bettingbetas
Complete, First published Jan 20, 2024
Mature
ajshabeelangstangstwithhappyendingbetasquadbritishyoutubersbxblovechunkzflufffriendshipkennykingkennykingkennytvlovenikonikoomilanaoneshotoneshotcollectionrequestssadnesssharkysmutishwholesomeyoutubeyoutubers
NOT UPLOADING ANYMORE.

platonic/romantic relationships between Beta Squad (sharky, niko, aj, chunkz, kenny) have fun 🫶
Public Domain
ajshabeelangstangstwithhappyendingbetasquadbritishyoutubersbxblovechunkzflufffriendshipkennykingkennykingkennytvlovenikonikoomilanaoneshotoneshotcollectionrequestssadnesssharkysmutishwholesomeyoutubeyoutubers
Table of contents

75 parts

Sign up to add Beta Squad! (BxB) to your library and receive updates
or
Content Guidelines
You may also like
Ceilings- AJxNiko by ajswifie1
52 parts Complete Mature
Kinda based off the song. Aj and Niko were as close as best friends could be. But sometimes, being just close is worse than being strangers * THIS STORY IS FOR WRITING PURPOSES ONLY! I DO NOT THINK THEY ARE TOGETHER
The Waters - A Beta Squad Story (bxb) by straykats143
48 parts Complete Mature
A story about a YouTube group of 5 best friends, based in London, called The Beta squad. The story tells the hardships and struggles the 5 men go through together. All living in a house together, making videos and hanging out. When romantic feelings and mental health becomes the big topic in the group. Find out what happens to the group. Will they stick together? Or will their feelings cause the group to get rocky. Aj x Niko Sharky x Kenny
𝘾𝙡𝙤𝙨𝙞𝙣𝙜 𝘿𝙤𝙤𝙧𝙨 [𝙉𝙞𝙠𝙤 𝙭 𝙆𝙚𝙣𝙣𝙮] | 𝘽𝙚𝙩𝙖𝙨𝙦𝙪𝙖𝙙 by -qlptra-
11 parts Complete Mature
「"𝐓𝐡𝐞 𝐠𝐨𝐨𝐬𝐞𝐛𝐮𝐦𝐩𝐬 𝐬𝐭𝐚𝐫𝐭 𝐭𝐨 𝐫𝐚𝐢𝐬𝐞, 𝐭𝐡𝐞 𝐦𝐨𝐦𝐞𝐧𝐭 𝐭𝐡𝐚𝐭 𝐦𝐲 𝐥𝐞𝐟𝐭 𝐡𝐚𝐧𝐝 𝐦𝐞𝐞𝐭𝐬 𝐲𝐨𝐮𝐫 𝐰𝐚𝐢𝐬𝐭"」 If there is one thing Niko had realized over the times he spent with The Beta Squad, Kenny specifically, was that the man was nowhere near his "brother". Trying to convince himself was stupid at some point in his life and he wonders why he kept rubbing it in Kenny's face and everyone else's. But all secrets are meant to be revealed at some point. And this one was running out of time very quickly.
BLUEBERRY | Aj Shabeel by lowveey
15 parts Complete
aj × reader | story completed now writing one-shots ^^ After a misunderstanding, ___ decides it's best for both to take a break, not knowing how much they'll miss each other's presence. read on dark mode !
Two Clueless Shmucks by ajshawheels0
49 parts Complete Mature
it's basc a story of Niko and Aj lmao realising their feelings for each other lol. i just find them so cute together. updates r never certain for now but i hope it's somewhat regular I made up a character, her name is Brielle. She's Niko's love interest who Aj is clearly jealous of. Bits of Sharky X Kenny in this fic too, theyre basically a couple in this lol I WAS INSPIRED TO MAKE THIS BOOK BC OF: Hehawis !TRIGGER WARNING! - guys this book does get very dark at times. There are mentions of suicide, attempted suicide, self harm, sexual abuse and rape. first upload was on 3rd Jan 2024 !!!! IF U ENJOYED THE SHARKY AND KENNY SHIP IN THIS BOOK, U CAN ENJOY THEM A WHOLE LOT MORE IN A NEW ONGOING BOOK IVE MADE SOLELY ON THEM!!!!
Shenny Instagram by Larrypaynhoranz
23 parts Complete
It's a Sharky x Kenny Instagram story Update: It's now also a Aj x Niko and Kai x Duke story IMPORTANT!! THIS IS ALL FOR FUN THX IF YOU DON'T LIKE IT DON'T READ IT YOU ARE NOT OBLIGATED TO CONSUME THIS CONTENT THX<33 luv
just my type. sharky by Summery-Kaya
20 parts Complete
𝙊𝙝, 𝙄 𝙙𝙤𝙣'𝙩 𝙠𝙣𝙤𝙬 𝙬𝙝𝙮 𝙨𝙝𝙚'𝙨 𝙟𝙪𝙨𝙩 𝙢𝙮 𝙩𝙮𝙥𝙚... in which AJ Shabeels cousin meets Sharky but they but heads causing tension between the two Collab with @Elambz
I miss you, I'm sorry by ajswifie1
40 parts Ongoing Mature
Uh, realised i wrote the description wrong 😭 i forgot to change it. Long stpry short: Aj and Niko hate each other, the boys dont know why, and now theyre forced to hang out. Thats it
Come Dine with Me - Beta Squad - One shots by ajswifie1
2 parts Ongoing Mature
req: One shots based around the come dine w me series. Kenny and Sharky AJ and Niko
Aj and niko - enemies to lovers by incognitowatermelon
15 parts Ongoing
"I fucking hate you!! Why can't you go away" "I fucking hate you more!! You short prick!" So I've realised... they don't hate each other enough. Chapter 7 and onwards will be promising. More like, evil.
You may also like
Slide 1 of 10
Ceilings- AJxNiko cover
The Waters - A Beta Squad Story (bxb) cover
𝘾𝙡𝙤𝙨𝙞𝙣𝙜 𝘿𝙤𝙤𝙧𝙨 [𝙉𝙞𝙠𝙤 𝙭 𝙆𝙚𝙣𝙣𝙮] | 𝘽𝙚𝙩𝙖𝙨𝙦𝙪𝙖𝙙 cover
BLUEBERRY | Aj Shabeel cover
Two Clueless Shmucks cover
Shenny Instagram cover
just my type. sharky cover
I miss you, I'm sorry cover
Come Dine with Me - Beta Squad - One shots cover
Aj and niko - enemies to lovers cover

Ceilings- AJxNiko

52 parts Complete Mature

Kinda based off the song. Aj and Niko were as close as best friends could be. But sometimes, being just close is worse than being strangers * THIS STORY IS FOR WRITING PURPOSES ONLY! I DO NOT THINK THEY ARE TOGETHER

More details