Kali : The Awakening
moon_fabler
  • Reads 437
  • Votes 87
  • Parts 25
  • Time 3h 31m
  • Reads 437
  • Votes 87
  • Parts 25
  • Time 3h 31m
moon_fabler
Ongoing, First published Feb 02, 2024
Mature
1 new part
darkmagicepicfantasyepictalefamilyfantasy-romancefantasyadventurefantasyfictiongodgoddessindialokamythicalcreaturesoathsscience-fantasyshivauniversewattys2024
**FEATURED in WATTPAD SCIENCE FICTION SCI FANTASY READING LIST**

"The lokas converge, aligning in a straight path,
Heralding the dissolution into the universe's endless void.
Beware, for the darkness approaches.

Within me, Shiva and Shakti unite.
I am the beginning, I am the end.
I am the One and All.
The power of everything and nothing at once."


⁂⁑⁂⁎⁂

Three years after the heart-wrenching loss of his family, Ryhan is shocked to discover that his wife, Antra, is living a completely different life as a powerful goddess, the Sun Time Charmer. His astonishment turns to urgency when he learns that their daughter, the last bond between them, is in grave danger of being sacrificed by Antra's enemies. Antra, burdened with the responsibilities of saving the Lokas and her daughter, is torn apart by seeing the love of her life after so many years. Together, they must act swiftly to rescue their daughter before time runs out and prevent the catastrophic rise of Kali Yuga.


****WATTY2024****
All Rights Reserved
darkmagicepicfantasyepictalefamilyfantasy-romancefantasyadventurefantasyfictiongodgoddessindialokamythicalcreaturesoathsscience-fantasyshivauniversewattys2024
Table of contents

25 parts

Sign up to add Kali : The Awakening to your library and receive updates
or
Content Guidelines
You may also like
"And Then I Met You" by the_meltinglines
83 parts Complete Mature
Life gives ups and downs to everyone. Some sad memories & some good one. But when sometimes the sad memories are related to a good person, it breaks them.And more when those sad memories are burdened with a guilt. Meet Mihir Malhotra. The youngest billionaire of Asia. He's everything a woman would want. Looks, power, money everything. Got the handsome, charming looks and sharp eyes from his dad Abeer Malhotra, the heartbeat of business world at his time. With those determination & hard work from his mom, Meera Kapoor Malhotra, the fine business woman of her Era. But...even after having a loving family & all the world in his hands, Something haunted him. A past... But what!! And on another side... Meet Isha Mittal. The sweetheart of Baani Bajaj Mittal, the dimpled business woman of her time & The Kabeer Mittal, man known for his keen observation and few words. She's everything a man would desire for! Those long dark brown locks, that dimpled smile from her mother which can make anyone smile. And the cherry on the cake... Those blue eyes from Kabeer Mittal which are to die on. But getting everything on silver spoon doesn't always means bed of roses. It has thorns too! Yet, The main thing is... What happens when these two meet? The opposite personalities with same dedication! Where one is... Well clumsy & lazy, while another is, disciplined and well organized. When one always has a smile on face, while other one rarely smiles. When one is hell bent to never loose, while another one is hell bent to... Make the other one loose. When one speaks just when needed, while another...stops when.. Well she doesn't stop! But, fire can melt ice and water can stop fire. But to gather fire & water... Can it survive? Let's see! Dive down the journey of Ms. Hungry Hulk & Mr. Angry Hulk!
ᴍʀ ᴏʙᴇʀᴏɪ by midn8thots
50 parts Complete Mature
ʜᴇ ᴅɪᴅɴ'ᴛ ᴋɴᴏᴡ ᴡʜᴀᴛ ᴡᴀs ʜᴀᴘᴘᴇɴɪɴɢ ᴛᴏ ʜɪᴍ, ɪᴛ's ɴᴏᴛ ʜɪᴍ, ʜᴇ sʜᴏᴜʟᴅɴ'ᴛ ғᴇᴇʟ ᴛʜᴇsᴇ ғᴇᴇʟɪɴɢ ᴛᴏᴡᴀʀᴅs ʜᴇʀ, ʜᴇ ɪs ᴀ ᴄᴏʟᴅʜᴇᴀʀᴛᴇᴅ ᴘᴇʀsᴏɴ, ᴇᴠᴇʀʏᴏɴᴇ ғᴇᴀʀs ʜɪᴍ, ʜᴇ ᴡᴀɴᴛᴇᴅ ᴛᴏ ᴘᴜsʜ ʜᴇʀ ᴀᴡᴀʏ, ʙᴜᴛ ᴛʜᴇ ᴍᴇʀᴇ ᴛʜᴏᴜɢʜᴛ ᴏғ ʟᴏᴏsɪɴɢ ʜᴇʀ ᴅʀɪᴠᴇs ʜɪᴍ ᴄʀᴀᴢʏ, ғᴜᴄᴋ ʜᴇ sʜᴏᴜʟᴅɴ'ᴛ ғᴇᴇʟ ᴀɴʏᴛʜɪɴɢ ғᴏʀ ʜᴇʀ, sʜᴇ's ɪs ʜɪs ɢʀᴀɴᴅᴍᴏᴛʜᴇʀ's ғʀɪᴇɴᴅ ɢʀᴀɴᴅ ᴅᴀᴜɢʜᴛᴇʀ, ᴏɴ ᴛᴏᴘ ᴏғ ᴄʜᴇʀʀʏ sʜᴇ's ʜɪs sᴇᴄʀᴇᴛᴀʀʏ, ᴀ ʙᴇᴀᴜᴛʏ ᴡɪᴛʜ ʙʀᴀɪɴ... ««««««««««««««******************»»»»»»»»»»»»»» 𝐼 𝑐𝑎𝑚𝑒 𝑜𝑢𝑡 𝑜𝑓 𝑠ℎ𝑜𝑤𝑒𝑟 𝑜𝑛𝑙𝑦 𝑡𝑜 𝑠𝑒𝑒 ℎ𝑖𝑚 𝑏𝑎𝑐𝑘 𝑓𝑎𝑐𝑖𝑛𝑔 𝑚𝑒, 𝐻𝑒 𝑡𝑢𝑟𝑛𝑒𝑑 𝑎𝑟𝑜𝑢𝑛𝑑, ℎ𝑖𝑠 𝑒𝑦𝑒𝑠 𝑤𝑒𝑛𝑡 𝑤𝑖𝑑𝑒, 𝑖 𝑐𝑜𝑢𝑙𝑑 𝑠𝑒𝑒 ℎ𝑖𝑠 𝑒𝑦𝑒𝑠 𝑔𝑜𝑖𝑛𝑔 𝑑𝑎𝑟𝑘, 𝐼 ℎ𝑒𝑎𝑟𝑑 ℎ𝑖𝑚 𝑚𝑢𝑡𝑡𝑒𝑟 𝐹𝑢𝑐𝑘, 𝑚𝑎𝑘𝑖𝑛𝑔 𝑚𝑒 𝑟𝑒𝑎𝑙𝑖𝑧𝑒 𝑖'𝑚 𝑜𝑛𝑙𝑦 𝑖𝑛 𝑡𝑜𝑤𝑒𝑙,,,,, ««««««««««««««******************»»»»»»»»»»»»»» A story of coldhearted business man, who has everything, power, money, status expect happiness, dwell himself in business, one glance , people tremble with fear. Then she happened his secretary, full of life, jolly, sassy, totally opposite to him, she's someone who he had never encountered in his entire life, he was falling for her. His inner beast wanted to claim her has his.... #1-Shivika (14/04/2021) #4-Shivay (17/4/202
The Moon to my night by inheritedVibes
62 parts Ongoing
Two imperfectly perfect fell in love. Something happened and they drifted apart. What will happen when they cross each other's path again? Will Aradhaya forgive Rudransh for breaking her heart? Read to know! .................. "It will. You won't be able to help yourself from falling for me again, and you'll keep falling for me every day." He declared, pulling me back up and twirling me again. "This time, you'll never fall out of love with me." This man and his confidence. Sometimes I wished to laugh at his words, but they seemed to seep under my skin and infuriate me. As we moved into a series of side steps, our eyes locked, and the rest of the world faded away. "You wish," I said, my breath coming quicker. "And it will never be fulfilled." His hand slid from my waist to my hand, lifting our arms for an elegant turn. "I don't wish; I pray. Every day, every night, every second of the time I breathe, I pray, and prayers are always answered." The music intensified, and we matched its energy with a dramatic lift, my body stretching out in perfect alignment as he held me high. "I'll pray otherwise then," I whispered, and I felt his grip tighten in response. As the song reached its climax, we moved into the final sequence. Our steps quickened, and we executed a series of synchronized turns and dips, the chemistry between us undeniable. "To never fall for you again," I spoke, breathless but exhilarated. He smiled, his eyes never leaving mine as he spun me into a final, breathtaking dip. "Your Mahadev is in my favor this time." .... Explore this enthralling tale about two passionate individuals and their fiery romance, coupled with heartwarming family moments.
Time travel to mahabharat era by secretlifeofleena
25 parts Ongoing
Time travel of six girls from kaliyug to dwapar Yug in mahabharat Ara. See what will happen when they land in dwapar yug? how many twists life have hold for them? Will they fell in love with kuru princes? Will they help kauravas and pandavs to get together? Disclaimer:- This is all my imagination and has nothing to do with real story. This is a fiction story. Enjoy😊 ○○○○○○○○○○○○○○○○○○○○○○○○○○ Rankings.... #1 in Haldi. 29/5/2024 #1 in Sangeet. 29/5/2024 #1 in Leena. 31/5/2024 #1 in Janvi. 31/5/2024 ~•••~••••~•••••••~••••~•••~ #2 in Hinduism. 7/7/2024 ~•••~••••~•••••••~••••~•••~ #3 in Yudhisthir. 29/5/2024 ~•••~••••~•••••••~••••~•••~ #5 in Hinduism. 31/5/2024 #5 in Yudhisthir. 1/6/2024
Abhorred Love (Kanha ff) by gloryuniverse
65 parts Ongoing
"In this birth you never loved me shri Narayan. I did everything to make happy but you never gave me a chance. Thus, when my soul departs from this body i only want peace which i never got in this birth. If I take rebirth I shall forget everything about you. I don't want to meet you in my next birth, but by any chance we meet I shall not fall in love with you. You will make me fall in love and the pain which i went through, same pain you should feel. When we meet again there will nothing normal. I will only hate you." saying this the woman fall in river of Ganga. Hearing this tears rolling down from Shri and Narayan face. He said "I accept your wish, but we will meet again priye. Even if you don't want to. I promise to make you fall in love with me priye." •÷This the story of Obsession, love and redemption of a crazy princess and celestial god who is also preserver of the universe. Notice:- This has nothing to do with the reality my readers. It's just my imagination. I apologize if I hurt anyone emotions. If you don't like them please don't read. Don't hate. • All the pics including book covers the credits goes to their owners.
𝐀𝐑𝐑𝐀𝐍𝐆𝐄𝐃 𝐋𝐎𝐕𝐄 by Romantic_Fanatics
30 parts Complete Mature
#BOOK1 of Devil&Angel series ♡ 𝓕𝓸𝓻 𝓽𝓱𝓮 𝔀𝓸𝓻𝓵𝓭 𝓲𝓽 𝔀𝓪𝓼 𝓪𝓷 𝓐𝓻𝓻𝓪𝓷𝓰𝓮 𝓜𝓪𝓻𝓻𝓲𝓪𝓰𝓮, 𝓫𝓾𝓽 𝓲𝓷 𝓻𝓮𝓪𝓵𝓲𝓽𝔂 𝓲𝓽 𝔀𝓪𝓼 𝓽𝓱𝓮𝓲𝓻 𝓐𝓻𝓻𝓪𝓷𝓰𝓮𝓭 𝓛𝓸𝓿𝓮 ! ♡ ♡ ♡ " App mujhe pasand nahi.. " I said hesitantly. " Mujhe tum bohot pasand ho. Agli wajah? " He stated bluntly. " App mujhse bade hai. " " Toh main jyada pyaar kar lunga .. " gasped hearing him. " Appko sharam nahi aati? " " Woh tum kar lena. Main besharam he theek hu. " His bold answer made her amazed . ♡ ♡ ♡ " You were mine since the moment I laid my eyes on you sweetheart... Today or tomorrow, doesn't matter , I'll make sure I'm the only one who loves you, touches you and makes you feel things that you never felt before. " He thought looking at the numerous pictures or her that was all over his room. ♡ ♡ ♡ A marriage alliance that was arranged by the 𝐃𝐄𝐕𝐈𝐋 to make the 𝐀𝐍𝐆𝐄𝐋 his ! ♡ ♡ ♡ He was adamant to make her his while she had her own reasons to stay away from him.. She was the reason he believed in love unknown to the fact that she has already lost her beliefs. It wasn't going to be easy for the Devil to bring his Angel in his life but we are talking about Kabir Rathore , The Devil who if wants something, he gets it by hook or by crook. ♡ ♡ ♡ ᵀʳᵒᵖᵉˢ : ᴬᵍᵉ ᵍᵃᵖ ᴳʳᵘᵐᵖʸ × ˢᵘⁿˢʰⁱⁿᵉ ᴰᵉᵛⁱˡ × ᴬⁿᵍᵉˡ ᴰᴱˢᴵ ᴿᴼᴹᴬᴺᶜᴱ Started: 28.12.23 Ended :
His sunshine, His beauty [COMPLETED] by sonals_writes
48 parts Complete Mature
"Jojo, I love you" she said "Tara, you are just 15" I said "No!! until I will turn 18, you will find someone else" she said "No, I won't" I said with a smile "Promise???" she asked forwarding her hand "Promise SUNSHINE" I promised taking her hand _______________________________________ " That son of a b*tch, AT " I hissed looking at my bleeding hand. "Oh my god!!! your hand is bleeding so much" came an angelic voice which broke my chain of thoughts. I turned around and saw the most beautiful woman, just like an angel. . "Are you alright?" came the angel's voice I just nodded still mesmerized by her beauty. Suddenly, she took my rough hands in her soft ones and tied a handkerchief around it. "Now it's better!" she said with a smile which made my heart flutter with unknown emotions. "Taraksha Sharma" she extended her hand "Kabir Rathod" I said with a smile that I myself don't know existed. "Please take care Kabir! Bye!" She said and went away. Not so soon angel, not so soon You will be mine, just mine Because BEAUTY belongs only to her BEAST. ________________________________________ "Nice to meet you Mr. Rajvansh" "Same here Mr. Rathod, So, where is your fiance?" "Oh! she is just coming" "Ohh! Ok" "Hello Mr. Rajvansh" I turned around and my world stopped. "Tara" ________________________________________ There are some scenes that may trigger you. So, read-only if you are comfortable. Cover- @Lady_whistleup
Mrs Singhania: A Saga Of Unconditional Love by thatmiraclepen
41 parts Complete Mature
Agastya Singhania, well known leader of phoenix mafia gang and man of his words. He is known for his punctuality and strict adherence to routines. He believes that time is money and does not tolerate any kind of delays or excuses. He is used to getting what he wants and does not take no for an answer.He has no qualms about showing his power and will not hesitate to use force to get his way. He vows to take revenge from the man who destroyed his life from childhood even if it cost his own death. Shivani sharma, a trained kathak dancer whose life is dance and his brother.she is crazy about dance,Marine drives, beaches, rain, anklet and sunsets. Simple things matter the most,she always tries to fill everyone's life with happiness which is lacking in her life most. "Shivani sharma" A loud heavy voice reached her ears,sending shivers to her body and stop her feets to take any steps further. she don't know who is he,what he wants, how came he fall for her but the way he declared she is going to be his wife. He stand on those words, as he killed her groom at the mandap and decided to filled the her hair with his blood as vermillion and stepping into holy bond of marriage. What will happen, when two people from different worlds decide to tie in the holy bond of marriage. What will happen when the mafia, known for their perpetually bloody hands, chose to embrace the red substance and adorned her hairline with red vermillion, symbolising an eternal bond. Did their journey come to an end or will it start a new Beginning of destruction ? [प्रेम Gatha series #1] Started : 14th March,2024 Ended: 9th June,2024 Wattpad creator program Rankings Mumbai #1 27-04-2024 2024 #1 9th June 2024 Fictional #1 27th June 2024 Wattpadindia #1 27th June 2024
𝐎𝐍𝐋𝐘 𝐇𝐄𝐑𝐒 by losttverse
38 parts Ongoing Mature
"woh galat nahi tha , humare milne ka hi waqat sahi nahin tha" She was like a free bird, a carefree soul and an introvert but when her wedding at an early age took place. A lot of events took place turning her whole life upside down when her secrets were revealed in front of her in-laws and families. And now she was alone with her three year old child who was born on the day when everyone she loved and cared for were taken away. 🎕 He was like a happy breeze on a summer day but his life took a turn when he met fake people & friends, a deep betrayal shattered his heart. But now he was a different person. A cold devil as people say but no one knew the way he cried on those days. He was now a thunderstorm and a closed book whose key was lost and never found. ღ 𝗔𝗱𝗵𝘃𝗶𝗸𝗮 & 𝗥𝗮𝗷𝘃𝗲𝗲𝗿 ღ °。°。°。°。°。°。°。°。°。°。°。°。°。°。°。°。°。°。°。°。°。 "I am cursed Raj whoever loves me ends up dying . I am poison to your life . I am a venomous serpent who will kill you ." Her words and cries hurt him , stabbed him to death . She didn't know the power of words but she somehow knows the power of emotions and how they affect him . "You are not , I say you are not . But if you think so then I will die peacefully from your poison . I will be a happy man to be cursed by you , hit by you and killed by you ." His sincere words felt like a mere air for her but she is unaware of the power of emotions . °。°。°。°。°。°。°。°。°。°。°。°。°。°。°。°。°。°。 ✾ 𝔗ℜ𝔒𝔓𝔈𝔖 ✾ ~ Grumpy x Sunshine ~ Single Mother ~ Baby Cupid ~ he fell first & harder ~ broken hearts ~ he is a softie for her ~ sad past
Meant to be together | ✔ by Chronicles_of_love
41 parts Complete
Unedited! Wherein one is deeply in love while the other has vowed to never fall in love again. **************************************** Arjun Raichand has always loved a girl unknown to her. When he gets the perfect chance to make her acknowledge him, and that too as a husband ,What could possibly stop him? Krisha Mahajan has finally now believed she isn't meant for love nor commitments, she makes every guy reject her one way or the other. But what happens when one particular human is hellbent on marrying her? Dive in the story and see the journey of two souls, who are meant to be together. Started: 16 May 2023 Ended: 16 May 2024 A/N : English is not my first language, expect grammatical mistakes and punctuation errors. But I promise you'll definitely enjoy it. Happy Reading~~ What are you all waiting for, click the start reading button ASAP
You may also like
Slide 1 of 10
"And Then I Met You" cover
ᴍʀ ᴏʙᴇʀᴏɪ cover
The Moon to my night cover
Time travel to mahabharat era cover
Abhorred Love (Kanha ff) cover
𝐀𝐑𝐑𝐀𝐍𝐆𝐄𝐃 𝐋𝐎𝐕𝐄 cover
His sunshine, His beauty [COMPLETED] cover
Mrs Singhania: A Saga Of Unconditional Love cover
𝐎𝐍𝐋𝐘 𝐇𝐄𝐑𝐒 cover
Meant to be together | ✔ cover

"And Then I Met You"

83 parts Complete Mature

Life gives ups and downs to everyone. Some sad memories & some good one. But when sometimes the sad memories are related to a good person, it breaks them.And more when those sad memories are burdened with a guilt. Meet Mihir Malhotra. The youngest billionaire of Asia. He's everything a woman would want. Looks, power, money everything. Got the handsome, charming looks and sharp eyes from his dad Abeer Malhotra, the heartbeat of business world at his time. With those determination & hard work from his mom, Meera Kapoor Malhotra, the fine business woman of her Era. But...even after having a loving family & all the world in his hands, Something haunted him. A past... But what!! And on another side... Meet Isha Mittal. The sweetheart of Baani Bajaj Mittal, the dimpled business woman of her time & The Kabeer Mittal, man known for his keen observation and few words. She's everything a man would desire for! Those long dark brown locks, that dimpled smile from her mother which can make anyone smile. And the cherry on the cake... Those blue eyes from Kabeer Mittal which are to die on. But getting everything on silver spoon doesn't always means bed of roses. It has thorns too! Yet, The main thing is... What happens when these two meet? The opposite personalities with same dedication! Where one is... Well clumsy & lazy, while another is, disciplined and well organized. When one always has a smile on face, while other one rarely smiles. When one is hell bent to never loose, while another one is hell bent to... Make the other one loose. When one speaks just when needed, while another...stops when.. Well she doesn't stop! But, fire can melt ice and water can stop fire. But to gather fire & water... Can it survive? Let's see! Dive down the journey of Ms. Hungry Hulk & Mr. Angry Hulk!

More details