Kali : The Awakening
moon_fabler
  • Reads 460
  • Votes 87
  • Parts 25
  • Time 3h 31m
  • Reads 460
  • Votes 87
  • Parts 25
  • Time 3h 31m
moon_fabler
Ongoing, First published Feb 02, 2024
Mature
darkmagicepicfantasyepictalefamilyfantasy-romancefantasyadventurefantasyfictiongodgoddessindialokamythicalcreaturesoathsscience-fantasyshivauniversewattys2024
**FEATURED in WATTPAD SCIENCE FICTION SCI FANTASY READING LIST**

"The lokas converge, aligning in a straight path,
Heralding the dissolution into the universe's endless void.
Beware, for the darkness approaches.

Within me, Shiva and Shakti unite.
I am the beginning, I am the end.
I am the One and All.
The power of everything and nothing at once."


⁂⁑⁂⁎⁂

Three years after the heart-wrenching loss of his family, Ryhan is shocked to discover that his wife, Antra, is living a completely different life as a powerful goddess, the Sun Time Charmer. His astonishment turns to urgency when he learns that their daughter, the last bond between them, is in grave danger of being sacrificed by Antra's enemies. Antra, burdened with the responsibilities of saving the Lokas and her daughter, is torn apart by seeing the love of her life after so many years. Together, they must act swiftly to rescue their daughter before time runs out and prevent the catastrophic rise of Kali Yuga.


****WATTY2024****
All Rights Reserved
darkmagicepicfantasyepictalefamilyfantasy-romancefantasyadventurefantasyfictiongodgoddessindialokamythicalcreaturesoathsscience-fantasyshivauniversewattys2024
Table of contents

25 parts

Sign up to add Kali : The Awakening to your library and receive updates
or
Content Guidelines
You may also like
Meant to be together | ✔ by Chronicles_of_love
41 parts Complete
Unedited! Wherein one is deeply in love while the other has vowed to never fall in love again. **************************************** Arjun Raichand has always loved a girl unknown to her. When he gets the perfect chance to make her acknowledge him, and that too as a husband ,What could possibly stop him? Krisha Mahajan has finally now believed she isn't meant for love nor commitments, she makes every guy reject her one way or the other. But what happens when one particular human is hellbent on marrying her? Dive in the story and see the journey of two souls, who are meant to be together. Started: 16 May 2023 Ended: 16 May 2024 A/N : English is not my first language, expect grammatical mistakes and punctuation errors. But I promise you'll definitely enjoy it. Happy Reading~~ What are you all waiting for, click the start reading button ASAP
ᴍʀ ᴏʙᴇʀᴏɪ by midn8thots
50 parts Complete Mature
ʜᴇ ᴅɪᴅɴ'ᴛ ᴋɴᴏᴡ ᴡʜᴀᴛ ᴡᴀs ʜᴀᴘᴘᴇɴɪɴɢ ᴛᴏ ʜɪᴍ, ɪᴛ's ɴᴏᴛ ʜɪᴍ, ʜᴇ sʜᴏᴜʟᴅɴ'ᴛ ғᴇᴇʟ ᴛʜᴇsᴇ ғᴇᴇʟɪɴɢ ᴛᴏᴡᴀʀᴅs ʜᴇʀ, ʜᴇ ɪs ᴀ ᴄᴏʟᴅʜᴇᴀʀᴛᴇᴅ ᴘᴇʀsᴏɴ, ᴇᴠᴇʀʏᴏɴᴇ ғᴇᴀʀs ʜɪᴍ, ʜᴇ ᴡᴀɴᴛᴇᴅ ᴛᴏ ᴘᴜsʜ ʜᴇʀ ᴀᴡᴀʏ, ʙᴜᴛ ᴛʜᴇ ᴍᴇʀᴇ ᴛʜᴏᴜɢʜᴛ ᴏғ ʟᴏᴏsɪɴɢ ʜᴇʀ ᴅʀɪᴠᴇs ʜɪᴍ ᴄʀᴀᴢʏ, ғᴜᴄᴋ ʜᴇ sʜᴏᴜʟᴅɴ'ᴛ ғᴇᴇʟ ᴀɴʏᴛʜɪɴɢ ғᴏʀ ʜᴇʀ, sʜᴇ's ɪs ʜɪs ɢʀᴀɴᴅᴍᴏᴛʜᴇʀ's ғʀɪᴇɴᴅ ɢʀᴀɴᴅ ᴅᴀᴜɢʜᴛᴇʀ, ᴏɴ ᴛᴏᴘ ᴏғ ᴄʜᴇʀʀʏ sʜᴇ's ʜɪs sᴇᴄʀᴇᴛᴀʀʏ, ᴀ ʙᴇᴀᴜᴛʏ ᴡɪᴛʜ ʙʀᴀɪɴ... ««««««««««««««******************»»»»»»»»»»»»»» 𝐼 𝑐𝑎𝑚𝑒 𝑜𝑢𝑡 𝑜𝑓 𝑠ℎ𝑜𝑤𝑒𝑟 𝑜𝑛𝑙𝑦 𝑡𝑜 𝑠𝑒𝑒 ℎ𝑖𝑚 𝑏𝑎𝑐𝑘 𝑓𝑎𝑐𝑖𝑛𝑔 𝑚𝑒, 𝐻𝑒 𝑡𝑢𝑟𝑛𝑒𝑑 𝑎𝑟𝑜𝑢𝑛𝑑, ℎ𝑖𝑠 𝑒𝑦𝑒𝑠 𝑤𝑒𝑛𝑡 𝑤𝑖𝑑𝑒, 𝑖 𝑐𝑜𝑢𝑙𝑑 𝑠𝑒𝑒 ℎ𝑖𝑠 𝑒𝑦𝑒𝑠 𝑔𝑜𝑖𝑛𝑔 𝑑𝑎𝑟𝑘, 𝐼 ℎ𝑒𝑎𝑟𝑑 ℎ𝑖𝑚 𝑚𝑢𝑡𝑡𝑒𝑟 𝐹𝑢𝑐𝑘, 𝑚𝑎𝑘𝑖𝑛𝑔 𝑚𝑒 𝑟𝑒𝑎𝑙𝑖𝑧𝑒 𝑖'𝑚 𝑜𝑛𝑙𝑦 𝑖𝑛 𝑡𝑜𝑤𝑒𝑙,,,,, ««««««««««««««******************»»»»»»»»»»»»»» A story of coldhearted business man, who has everything, power, money, status expect happiness, dwell himself in business, one glance , people tremble with fear. Then she happened his secretary, full of life, jolly, sassy, totally opposite to him, she's someone who he had never encountered in his entire life, he was falling for her. His inner beast wanted to claim her has his.... #1-Shivika (14/04/2021) #4-Shivay (17/4/202
"Bound By Tradition Unbound By Love" ✅ by bhadri_writes
79 parts Complete Mature
Top hash tags #1 - fictional character #2 - celebrity #3- Sizzling #3- celebrity #3- fictional characters #4- couple Dear Readers, Before you embark on the journey of "Bound by Tradition Unbound by Love" I want to offer you a small heads up. In certain parts of southern India, there exists a unique cultural practice where a sister's daughter can marry her brother's son, or vice versa. This may be unfamiliar to some readers, but it's important to note that it is a legal and accepted Hindu practice in those regions. If you are comfortable with and open to exploring such cultural nuances and traditions, I invite you to delve into the wonderful love story between Arjun and Siya. Their journey is rich with emotion, cultural depth, and the complexities of love in the backdrop of tradition. We hope you enjoy the story and find resonance in the beautiful tapestry of their relationship. Arjun, known for his reserved demeanor, crosses paths with Siya, a vibrant and lively girl. Despite their differing backgrounds, sparks fly between them. Arjun, labeled a playboy, while Siya dreams of being the cherished first love of her future husband. Their initial encounters are fraught with misunderstandings and misconceptions. However, circumstances lead them to spend more time together, allowing glimpses beneath their facades. As they navigate unexpected situations, Arjun's guarded nature slowly unravels, revealing a compassionate and genuine soul. Siya, in turn, sees beyond her preconceptions, discovering the depth and sincerity in Arjun's character. Explore the unique customs of Hindu South Indian tradition, where the union of a brother's child with a sister's child is a common practice, inviting readers to approach this story with an open mind and embrace the cultural diversit within the tradition.
The Moon to my night ✔️ by inheritedVibes
71 parts Complete
Two imperfectly perfect fell in love. Something happened and they drifted apart. What will happen when they cross each other's path again? Will Aradhaya forgive Rudransh for breaking her heart? Read to know! .................. "It will. You won't be able to help yourself from falling for me again, and you'll keep falling for me every day." He declared, pulling me back up and twirling me again. "This time, you'll never fall out of love with me." This man and his confidence. Sometimes I wished to laugh at his words, but they seemed to seep under my skin and infuriate me. As we moved into a series of side steps, our eyes locked, and the rest of the world faded away. "You wish," I said, my breath coming quicker. "And it will never be fulfilled." His hand slid from my waist to my hand, lifting our arms for an elegant turn. "I don't wish; I pray. Every day, every night, every second of the time I breathe, I pray, and prayers are always answered." The music intensified, and we matched its energy with a dramatic lift, my body stretching out in perfect alignment as he held me high. "I'll pray otherwise then," I whispered, and I felt his grip tighten in response. As the song reached its climax, we moved into the final sequence. Our steps quickened, and we executed a series of synchronized turns and dips, the chemistry between us undeniable. "To never fall for you again," I spoke, breathless but exhilarated. He smiled, his eyes never leaving mine as he spun me into a final, breathtaking dip. "Your Mahadev is in my favor this time." .... Explore this enthralling tale about two passionate individuals and their fiery romance, coupled with heartwarming family moments.
Rudra Tara by authordivyaa
37 parts Ongoing Mature
"𝐈 𝐰𝐚𝐧𝐭 𝐭𝐨 𝐥𝐨𝐯𝐞 𝐲𝐨𝐮 𝐢𝐧 𝐞𝐯𝐞𝐫𝐲 𝐩𝐨𝐬𝐬𝐢𝐛𝐥𝐞 𝐰𝐚𝐲. 𝐖𝐡𝐞𝐭𝐡𝐞𝐫 𝐢𝐭'𝐬 𝐛𝐞𝐜𝐨𝐦𝐢𝐧𝐠 𝐲𝐨𝐮𝐫 𝐜𝐨𝐦𝐟𝐨𝐫𝐭 𝐩𝐥𝐚𝐜𝐞 𝐨𝐫 𝐭𝐡𝐞 𝐨𝐧𝐞 𝐰𝐡𝐨 𝐮𝐭𝐭𝐞𝐫𝐥𝐲 𝐫𝐮𝐢𝐧𝐬 𝐲𝐨𝐮 𝐢𝐧 𝐛𝐞𝐝,𝐓𝐚𝐫𝐚" ✮ ⋆ ˚｡𖦹 ⋆｡°✩ ★ 𝐑𝐮𝐝𝐫𝐚𝐤𝐬𝐡 ᥫ᭡ 𝐓𝐚𝐫𝐚 ★ ✮ ⋆ ˚｡𖦹 ⋆｡°✩ Start : 13.03.2024 End :
SOLD TO HIM (FSC'S SPIN OFF) by YoungMinds1892
24 parts Ongoing
(FATE'S SEALED CONNECTION'S SPIN OFF) "You have to marry him. He is the only one who can get us out of this jail. Shanaya! I am your mother. I have fed you for all these years. You have to do this for me. Consider this as a payment for all that I have done for you and you shall be free. I promise you that I will not meddle in your life from then. You may do whatever you want. What ever your husband asks you to" Daamini said without any guilt in her voice. Shanaya was still standing in the cell with tears streaming down her eyes as she heard what her mother said. "I am ready mom. Arrange the date." Shanaya said and moved out without glancing back. . . . . . "You are husband and wife now." The priest said as there were only 3 people in that hall. The bride, the groom and the groom's secretary. They had a secret marriage. . . . . "Your mother sold you to me. I have paid to marry you." He said spitting nothing but facts on her face but this time, she was strong enough to not cry. . . . . "You do not know what a bitch of a wife you have 'JANEMAN'. I will show you exactly who Shanaya Rathore is" She said, her hands still around his neck as she sat comfortably in his lap leaving him shocked. WELL WELL!! THE MOST AWAITED STORY IS HERE. HOP INSIDE TO SEE THE STORY OF SHANAYA AND ARJUN. #DARK ROMANCE ALERT Book Cover Credits: _navyblueee_
Abhorred Love (Kanha ff) by gloryuniverse
71 parts Ongoing
"In this birth you never loved me shri Narayan. I did everything to make happy but you never gave me a chance. Thus, when my soul departs from this body i only want peace which i never got in this birth. If I take rebirth I shall forget everything about you. I don't want to meet you in my next birth, but by any chance we meet I shall not fall in love with you. You will make me fall in love and the pain which i went through, same pain you should feel. When we meet again there will nothing normal. I will only hate you." saying this the woman fall in river of Ganga. Hearing this tears rolling down from Shri and Narayan face. He said "I accept your wish, but we will meet again priye. Even if you don't want to. I promise to make you fall in love with me priye." •÷This the story of Obsession, love and redemption of a crazy princess and celestial god who is also preserver of the universe. Notice:- This has nothing to do with the reality my readers. It's just my imagination. I apologize if I hurt anyone emotions. If you don't like them please don't read. Don't hate. • All the pics including book covers the credits goes to their owners.
Time travel to mahabharat era by secretlifeofleena
25 parts Ongoing
Time travel of six girls from kaliyug to dwapar Yug in mahabharat Ara. See what will happen when they land in dwapar yug? how many twists life have hold for them? Will they fell in love with kuru princes? Will they help kauravas and pandavs to get together? Disclaimer:- This is all my imagination and has nothing to do with real story. This is a fiction story. Enjoy😊 ○○○○○○○○○○○○○○○○○○○○○○○○○○ Rankings.... #1 in Haldi. 29/5/2024 #1 in Sangeet. 29/5/2024 #1 in Leena. 31/5/2024 #1 in Janvi. 31/5/2024 ~•••~••••~•••••••~••••~•••~ #2 in Hinduism. 7/7/2024 ~•••~••••~•••••••~••••~•••~ #3 in Yudhisthir. 29/5/2024 ~•••~••••~•••••••~••••~•••~ #5 in Hinduism. 31/5/2024 #5 in Yudhisthir. 1/6/2024
𝐀𝐑𝐑𝐀𝐍𝐆𝐄𝐃 𝐋𝐎𝐕𝐄 by Romantic_Fanatics
30 parts Complete Mature
#BOOK1 of Devil&Angel series ♡ 𝓕𝓸𝓻 𝓽𝓱𝓮 𝔀𝓸𝓻𝓵𝓭 𝓲𝓽 𝔀𝓪𝓼 𝓪𝓷 𝓐𝓻𝓻𝓪𝓷𝓰𝓮 𝓜𝓪𝓻𝓻𝓲𝓪𝓰𝓮, 𝓫𝓾𝓽 𝓲𝓷 𝓻𝓮𝓪𝓵𝓲𝓽𝔂 𝓲𝓽 𝔀𝓪𝓼 𝓽𝓱𝓮𝓲𝓻 𝓐𝓻𝓻𝓪𝓷𝓰𝓮𝓭 𝓛𝓸𝓿𝓮 ! ♡ ♡ ♡ " App mujhe pasand nahi.. " I said hesitantly. " Mujhe tum bohot pasand ho. Agli wajah? " He stated bluntly. " App mujhse bade hai. " " Toh main jyada pyaar kar lunga .. " gasped hearing him. " Appko sharam nahi aati? " " Woh tum kar lena. Main besharam he theek hu. " His bold answer made her amazed . ♡ ♡ ♡ " You were mine since the moment I laid my eyes on you sweetheart... Today or tomorrow, doesn't matter , I'll make sure I'm the only one who loves you, touches you and makes you feel things that you never felt before. " He thought looking at the numerous pictures or her that was all over his room. ♡ ♡ ♡ A marriage alliance that was arranged by the 𝐃𝐄𝐕𝐈𝐋 to make the 𝐀𝐍𝐆𝐄𝐋 his ! ♡ ♡ ♡ He was adamant to make her his while she had her own reasons to stay away from him.. She was the reason he believed in love unknown to the fact that she has already lost her beliefs. It wasn't going to be easy for the Devil to bring his Angel in his life but we are talking about Kabir Rathore , The Devil who if wants something, he gets it by hook or by crook. ♡ ♡ ♡ ᵀʳᵒᵖᵉˢ : ᴬᵍᵉ ᵍᵃᵖ ᴳʳᵘᵐᵖʸ × ˢᵘⁿˢʰⁱⁿᵉ ᴰᵉᵛⁱˡ × ᴬⁿᵍᵉˡ ᴰᴱˢᴵ ᴿᴼᴹᴬᴺᶜᴱ Started: 28.12.23 Ended :
You may also like
Slide 1 of 9
Meant to be together | ✔ cover
ᴍʀ ᴏʙᴇʀᴏɪ cover
"Bound By Tradition Unbound By Love" ✅ cover
The Moon to my night ✔️ cover
Rudra Tara cover
SOLD TO HIM (FSC'S SPIN OFF) cover
Abhorred Love (Kanha ff) cover
Time travel to mahabharat era cover
𝐀𝐑𝐑𝐀𝐍𝐆𝐄𝐃 𝐋𝐎𝐕𝐄 cover

Meant to be together | ✔

41 parts Complete

Unedited! Wherein one is deeply in love while the other has vowed to never fall in love again. **************************************** Arjun Raichand has always loved a girl unknown to her. When he gets the perfect chance to make her acknowledge him, and that too as a husband ,What could possibly stop him? Krisha Mahajan has finally now believed she isn't meant for love nor commitments, she makes every guy reject her one way or the other. But what happens when one particular human is hellbent on marrying her? Dive in the story and see the journey of two souls, who are meant to be together. Started: 16 May 2023 Ended: 16 May 2024 A/N : English is not my first language, expect grammatical mistakes and punctuation errors. But I promise you'll definitely enjoy it. Happy Reading~~ What are you all waiting for, click the start reading button ASAP

More details