When realms collide (rewrite 2(previously rewrite 1))
QuiteManatee778
  • Membaca 12
  • Suara 0
  • Bagian 1
  • Durasi <5 mins
  • Membaca 12
  • Suara 0
  • Bagian 1
  • Durasi <5 mins
QuiteManatee778
Sedang dalam proses, Awal publikasi Feb 06, 2024
chayannedsmpeggsaskidsesmpfanfictionhermitcraftphillzaqsmpqsmpfanficrunawaysunnysideuptallulahtubbowatchers
That day the day everything changed it started as a normal day but that didn't last long  















This is a MCYT/Qsmp fanfic that will reference dsmp hermitcraft and esmp this is my second attempt at writing A fan fic and with the same story as the first please don't judge to hard new chapter every Friday is my goal and I am cross posting on Ao3

Edit im lazy so i just replace rewrite 1 with the new one
Domain Publik
chayannedsmpeggsaskidsesmpfanfictionhermitcraftphillzaqsmpqsmpfanficrunawaysunnysideuptallulahtubbowatchers
Daftar isi

1 bab

Daftar untuk menambahkan When realms collide (rewrite 2(previously rewrite 1)) ke perpustakaan Anda dan menerima pembaruan
or
#37tallulah
Panduan Muatan
anda mungkin juga menyukai
This is Me Trying ⭑ Rafe Cameron oleh -inslaytiable
63 Bagian Sedang dalam proses
After a year away at Kitty Hawk, Cassie Maybank returns to the Outerbanks with a determination to get her life back on track. To stay healthy, to make her own friends, to live a normal, steady life like every teenage girl should. But after hearing the news of the passing of one of her closest friends, and coming back to the island, she realizes her brother's letters severely underestimated how much had truly changed. A lot can happen in a year. Friends become strangers, brothers become liars. Some enemies become allies, some enemies become lovers. © Inslaytiable | June 22nd, 2023
Second || Robby Keene oleh ilikemyselffalot
58 Bagian Lengkap
"You do know how to eat a burger, right?" Summer rolled her eyes, looking up at him with feigned exasperation. "Of course I do," she retorted, then lowered her voice as she leaned in, her expression shifting to one of genuine concern. "Do you think they have a fork and knife? So I can, you know... cut it?" Robby Keene x fem!oc cobra kai season 3-6
Naruto: Copy System oleh Dragon155913
194 Bagian Sedang dalam proses
Reborn in the Naruto world, Shin Uzumaki finds himself in the doomed Land of Whirlpools. As a member of the Uzumaki Clan! Trapped in a world filled with war, betrayal, and unimaginable power, Shin's survival seems impossible.. Until it isn't!! [Ding! Replication System Activated!] [Daily Login Reward: Common Replication Card.] [Newbie Gift: Perfect Sage Body-Adamantine Sealing Chains-Four Symbols Seal] With the power to Copy any Ability-whether it's the Kekkei Genkai or Rinnegan or Forbidden jutsu-Shin begins his journey to dominate the Ninja World. [First task: Save Kushina and prevent the destruction of the Uzumaki Clan.]
Slytherin Boys Imagines oleh povsbyliz
146 Bagian Sedang dalam proses
Imagines and Oneshots from the Harry Potter Universe ✧₊⁺ Draco Malfoy, Mattheo Riddle, Theodore Nott, Lorenzo Berkshire, Pansy Parkinson, Tom Riddle. The story features AI generated images (created by me). Take a real look into the world of Hogwarts while falling in love with the Slytherin Boys! 𝘈𝘭𝘭 𝘤𝘩𝘢𝘳𝘢𝘤𝘵𝘦𝘳𝘴 𝘣𝘦𝘭𝘰𝘯𝘨 𝘵𝘰 𝘵𝘩𝘦𝘪𝘳 𝘳𝘦𝘴𝘱𝘦𝘤𝘵𝘪𝘷𝘦 𝘰𝘸𝘯𝘦𝘳𝘴, 𝘢𝘯𝘥 𝘤𝘰𝘱𝘺𝘳𝘪𝘨𝘩𝘵 𝘰𝘧 𝘵𝘩𝘦 𝘴𝘰𝘶𝘳𝘤𝘦 𝘮𝘢𝘵𝘦𝘳𝘪𝘢𝘭 𝘣𝘦𝘭𝘰𝘯𝘨𝘴 𝘵𝘰 𝘑.𝘒. 𝘙𝘰𝘸𝘭𝘪𝘯𝘨. 𝘊𝘰𝘷𝘦𝘳 𝘢𝘳𝘵 𝘧𝘳𝘰𝘮 𝘗𝘪𝘹𝘢𝘣𝘢𝘺 𝘶𝘴𝘦𝘳 Gaetanob1992.
𝑴𝒊𝒏-𝒆 || Min Ho x Reader oleh liv__ing
45 Bagian Lengkap
(season 2 out now!) 𝒊𝒏 𝒘𝒉𝒊𝒄𝒉 two famous teens fake date... until it becomes real. (xo, kitty) __ (Y/N) Novoselsky, born to two world-renowned movie stars, is attending KISS this year. Her mother is forcing her to live in Korea: and woo the son of one of her co-stars. His name? Min Ho. The problem is, he seems rude to her, and she clearly can't stand him. But the turns are tableing when he's the one chasing after her, and he's the one who has to prove himself. ❝ you make me do stupid things ❞ ❝ are you sure you aren't doing that on your own? ❞ ⋆ ｡𖦹° ⭒˚｡⋆ #1 in xokitty #1 in minho 2/15/25 #1 in sangheonlee #1 in minhoxokitty #1 in minhoxreader #1 in to all the boys 2/15/25 #6 in fanfiction
BURNING PILE » MIGUEL DIAZ oleh crownsmist
87 Bagian Sedang dalam proses
❝ALL MY TROUBLES ON A BURNING PILE ALL LIT UP AND I START TO SMILE.❞ MIGUEL DIAZ X FEM!OC SEASON 1 - 6 crownsmist, 2022 cover by @norasnetflix spanish & french translations are in my reading lists!
𝐇𝐄𝐀𝐑𝐓𝐒𝐇𝐀𝐊𝐄𝐑 ,, min ho (xo kitty) oleh megavrses
55 Bagian Sedang dalam proses
❝ he might think i'm weird, but i can't help it, i've fallen for him. ❞ 𝐢𝐧 𝐰𝐡𝐢𝐜𝐡 two enemies finally see the good side to each other started: 11.26.24 ended: achievements #4 in korean (OUT OF 1000+ STORIES) {1.19.25} #2 in jennyhan {1.19.25} #2 in toalltheboys {1.19.25} #5 in toalltheboysivelovedbefore {1.19.25} #1 in psistillloveyou {1.19.25} #1 in sangheonlee {1.19.25} #2 in kittycovey {1.19.25} #1 in alwaysandforeverlarajean {1.19.25} #3 in minhoxokitty {1.19.25} #1 in choiminyoung {1.19.25} #2 in anthony keyvan {1.19.25}
The Brink of Minds | Tim Bradford oleh writer_daydreamerr
45 Bagian Sedang dalam proses
❝I've been falling every day since I first met you.❞ stolen glances, hushed whispers, teasing breaths, lingering touches. 𝘖𝘳 𝘪𝘯 𝘸𝘩𝘪𝘤𝘩 𝙝𝙖𝙧𝙙𝙘𝙤𝙧𝙚 𝙢𝙚𝙚𝙩𝙨 𝙝𝙖𝙧𝙙𝙘𝙤𝙧𝙚, 𝘢𝘯𝘥 𝘮𝘢𝘨𝘯𝘦𝘵𝘴 𝘢𝘳𝘦 𝘮𝘦𝘢𝘯𝘵 𝘵𝘰 𝘢𝘵𝘵𝘳𝘢𝘤𝘵 𝘦𝘢𝘤𝘩 𝘰𝘵𝘩𝘦𝘳. ─ tim bradford x fem!oc ─ the rookie; s1 ~ s? ─ slow-burn, flirting, some spice ─ updating every other day!! ⊱ ──────── ➤ ──────── ⊰
COWGIRLS! | Yellowstone oleh religioninyourlips
89 Bagian Sedang dalam proses
"long live cowgirls." - in which the youngest of the dutton clan comes home [yellowstone] [ryan x oc] [book one]
Angelic - Rafe Cameron oleh Tori_vx
91 Bagian Sedang dalam proses
Madison Bamford has always lived on the small island, Outer Banks, some might even call it paradise on earth. The Bamford family was well known, being one of the most influential families around. If you wanted to be someone in the Kook hierarchy you would try and become close to them. Maddy had always been the perfect girl in everyone's eyes, she would do as she was told and she was amazing at pretending everything was perfect. That perfect life was about to change when she gets closer to the blonde Cameron boy, it started to make her think about choosing between good and evil. Because love makes you human and yet it makes you go beyond humanity. !Mature Content! 1st in #rafecameron -04.04.23, 07.06.23 Outerbanksstoryline Season 1 - completed 6. April 2023 Season 2 - completed 17. May 2023 Season 3 - completed 25. November 2024 Season 4 -
anda mungkin juga menyukai
Slide 1 of 10
This is Me Trying ⭑ Rafe Cameron cover
Second || Robby Keene cover
Naruto: Copy System cover
Slytherin Boys Imagines cover
𝑴𝒊𝒏-𝒆 || Min Ho x Reader cover
BURNING PILE » MIGUEL DIAZ cover
𝐇𝐄𝐀𝐑𝐓𝐒𝐇𝐀𝐊𝐄𝐑 ,, min ho (xo kitty) cover
The Brink of Minds | Tim Bradford cover
COWGIRLS! | Yellowstone cover
Angelic - Rafe Cameron cover

This is Me Trying ⭑ Rafe Cameron

63 Bagian Sedang dalam proses

After a year away at Kitty Hawk, Cassie Maybank returns to the Outerbanks with a determination to get her life back on track. To stay healthy, to make her own friends, to live a normal, steady life like every teenage girl should. But after hearing the news of the passing of one of her closest friends, and coming back to the island, she realizes her brother's letters severely underestimated how much had truly changed. A lot can happen in a year. Friends become strangers, brothers become liars. Some enemies become allies, some enemies become lovers. © Inslaytiable | June 22nd, 2023

Detail lengkap