JASA PASANG WALLPAPER VINYL DI BLIMBING MALANG
jasawp39
  • Reads 1
  • Votes 0
  • Parts 1
  • Time <5 mins
  • Reads 1
  • Votes 0
  • Parts 1
  • Time <5 mins
jasawp39
Ongoing, First published Feb 26, 2024
dekorasidindingdekorasirumahwallaperdindingwallpaperwallpapermalangidwallpapervinyl
JASA PASANG WALLPAPER VINYL DI BLIMBING MALANG

Bosan dengan suasana ruangan Anda? wallpaper dinding vinyl bisa menjadi solusi terbaik untuk Anda.

Wallpaper dinding vinyl sudah menjadi hal yang diminati banyak orang dan menjadi trend di era modern seperti sekarang karena memiliki banyak motif yang inovatif dan pemasangannya lebih cepat jika dibandingkan dengan menggunakan cat dinding pada dinding rumah. Wallpaper dinding vinyl terbuat dari kertas vinyl pilihan dan memiliki tekstur pada permukaannya. Jika Anda ingin segera memasang wallpaper di rumah Anda, Wallpaper Malang ID adalah solusi terbaik untuk Anda.

Wallpaper Malang ID menyediakan jasa pemasangan wallpaper dinding di Blimbing Malang dengan tukang profesional dan berpengalaman yang hasil pemasangannya tidak perlu diragukan lagi kerapihannya.

Ayo segera pasang wallpaper dinding vinyl dan bawalah suasana baru pada ruangan Anda dengan menghubungi Wallpaper Malang ID pada WhatsApp 087803144655 atau kunjungi Instagram @wallpapermalang.id dan dapatkan hasil yang luar biasa.

Ingat rumah, ingat wallpapermalang.id

#jasapasang #wallpaper #wallpapervinyl #wallpaperdinding #wallpaperdindingvinyl #dekorasirumah #dekorasidinding #wallpapermalangid
All Rights Reserved
dekorasidindingdekorasirumahwallaperdindingwallpaperwallpapermalangidwallpapervinyl
Table of contents

1 part

Sign up to add JASA PASANG WALLPAPER VINYL DI BLIMBING MALANG to your library and receive updates
or
#5dekorasirumah
Content Guidelines
You may also like
Lady of the Dark Mark | T.M.R by hxwarts24
65 parts Ongoing
❝ ah, but it was not tom riddle who made the dark mark. ❞ dumbledore's eyes fogged over, a memory of the once-smart and cunning student entering his mind as he stroked his white beard. ❝ then who did, sir? ❞ harry potter stared at the headmaster, dumbfounded. ❝ tom riddle's one and only love: ravena. athena ravena malfoy. lady of the dark mark. ❞ ────୨ৎ──── ↳ in which the first generation of the death eaters rise to power, and the malfoy twins choose the dark. one chooses to lead alongside the dark lord, while the other chooses to be a follower. ── .✦ tom riddle x oc ── .✦ dark academia, academic rivals to lovers, found family, slowburn. ── .✦ tom riddle era + first wizarding war era + marauder's era + golden trio era | second wizarding war era - regular updates every friday -
This is Me Trying ⭑ Rafe Cameron by -inslaytiable
60 parts Ongoing
After a year away at Kitty Hawk, Cassie Maybank returns to the Outerbanks with a determination to get her life back on track. To stay healthy, to make her own friends, to live a normal, steady life like every teenage girl should. But after hearing the news of the passing of one of her closest friends, and coming back to the island, she realizes her brother's letters severely underestimated how much had truly changed. A lot can happen in a year. Friends become strangers, brothers become liars. Some enemies become allies, some enemies become lovers. © Inslaytiable | June 22nd, 2023
𝑴𝒊𝒏-𝒆 || Min Ho x Reader by liv__ing
42 parts Complete
(season 2 out now!) 𝒊𝒏 𝒘𝒉𝒊𝒄𝒉 two famous teens fake date... until it becomes real. (xo, kitty) __ (Y/N) Novoselsky, born to two world-renowned movie stars, is attending KISS this year. Her mother is forcing her to live in Korea: and woo the son of one of her co-stars. His name? Min Ho. The problem is, he seems rude to her, and she clearly can't stand him. But the turns are tableing when he's the one chasing after her, and he's the one who has to prove himself. ❝ you make me do stupid things ❞ ❝ are you sure you aren't doing that on your own? ❞ ⋆ ｡𖦹° ⭒˚｡⋆ #1 in xokitty #1 in minho #1 in sangheonlee #1 in minhoxokitty #1 in minhoxreader #1 in to all the boys #6 in fanfiction
The Brink of Minds | Tim Bradford by writer_daydreamerr
34 parts Ongoing
❝I've been falling every day since I first met you.❞ stolen glances, hushed whispers, teasing breaths, lingering touches. 𝘖𝘳 𝘪𝘯 𝘸𝘩𝘪𝘤𝘩 𝙝𝙖𝙧𝙙𝙘𝙤𝙧𝙚 𝙢𝙚𝙚𝙩𝙨 𝙝𝙖𝙧𝙙𝙘𝙤𝙧𝙚, 𝘢𝘯𝘥 𝘮𝘢𝘨𝘯𝘦𝘵𝘴 𝘢𝘳𝘦 𝘮𝘦𝘢𝘯𝘵 𝘵𝘰 𝘢𝘵𝘵𝘳𝘢𝘤𝘵 𝘦𝘢𝘤𝘩 𝘰𝘵𝘩𝘦𝘳. ─ tim bradford x fem!oc ─ the rookie; s1 ~ s? ─ slow-burn, flirting, some spice ─ updating every other day!! ⊱ ──────── ➤ ──────── ⊰
𝐇𝐄𝐀𝐑𝐓𝐒𝐇𝐀𝐊𝐄𝐑 ,, min ho (xo kitty) by megavrses
45 parts Ongoing
❝ he might think i'm weird, but i can't help it, i've fallen for him. ❞ 𝐢𝐧 𝐰𝐡𝐢𝐜𝐡 two enemies finally see the good side to each other started: 11.26.24 ended: achievements #4 in korean (OUT OF 1000+ STORIES) {1.19.25} #2 in jennyhan {1.19.25} #2 in toalltheboys {1.19.25} #5 in toalltheboysivelovedbefore {1.19.25} #1 in psistillloveyou {1.19.25} #1 in sangheonlee {1.19.25} #2 in kittycovey {1.19.25} #1 in alwaysandforeverlarajean {1.19.25} #3 in minhoxokitty {1.19.25} #1 in choiminyoung {1.19.25} #2 in anthony keyvan {1.19.25}
ᴇʟʏꜱɪᴀɴ | BNHA by sxftreo
83 parts Ongoing
Various BNHA X Fem Reader. Where an inauspicious girl meets her doom and ultimately gets transported into the chaos of My Hero Academia.
The Day We Met --》Min Ho by Phoen7xWolf
32 parts Ongoing
(Writing season 2! 17/01/25 - ??) We all know the story of Kitty and Dae but what if Kitty had an adopted sister ? What if they both went to KISS together and what if they both fall for the best friends? This is the story of Sky Song Covey, tagging along with her sister Kitty Song Covey to KISS, in hopes to find her sister's boyfriend. She only joins so her sister would always have someone by her side, Kitty needed a realist by her side and someone to lean on in case something happens. But what if that's not all that happens? What if Sky finds her dream boy waiting on the other side of the world, but he's just out of reach of her fingertips? #3 Minho #2 xokitty (This is a O/C x Min Ho story, I only own Sky and her plot line. And please tell me if you see any mistakes and vote for any chapters that you like please and thank you!!! I will also write season 2 when it comes out!!!)
Naruto: Copy System by Dragon155913
158 parts Ongoing
Reborn in the Naruto world, Shin Uzumaki finds himself in the doomed Land of Whirlpools. As a member of the Uzumaki Clan! Trapped in a world filled with war, betrayal, and unimaginable power, Shin's survival seems impossible.. Until it isn't!! [Ding! Replication System Activated!] [Daily Login Reward: Common Replication Card.] [Newbie Gift: Perfect Sage Body-Adamantine Sealing Chains-Four Symbols Seal] With the power to Copy any Ability-whether it's the Kekkei Genkai or Rinnegan or Forbidden jutsu-Shin begins his journey to dominate the Ninja World. [First task: Save Kushina and prevent the destruction of the Uzumaki Clan.]
[Blue Archive] And Where All Hatred Begins by ihatenumber
200 parts Ongoing
One day, a curse befell Sensei. To the students, Sensei became the enemy, and he found himself in a position where he lost everything overnight. But Sensei does not resent the students. Because he is 'Sensei'. And Sensei has to face the calamity that would befall Kivotos once again. [블루 아카이브] 그리고 모든 증오가 시작되는 곳 Author: 비솔티 279+ Chapters (Ongoing) 1,210,000+ Total Words
Masked Obsession by ILoveDrarryAndAnime
42 parts Ongoing
"You're different from what I expected," she said softly. "How so?" he asked, glancing at her. "I don't know," she replied, searching for the right words. "You just... have this way of making people feel like they matter. Even here, in this... nightmare." He was quiet for a moment before responding. "You matter, Y/n. Don't forget that." OR Y/n wakes up in the deadly Squid Game, surrounded by strangers and fighting to survive. What she doesn't know is that the mysterious Frontman is watching her every move through the cameras- and she's caught his attention.
You may also like
Slide 1 of 10
Lady of the Dark Mark | T.M.R cover
This is Me Trying ⭑ Rafe Cameron cover
𝑴𝒊𝒏-𝒆 || Min Ho x Reader cover
The Brink of Minds | Tim Bradford cover
𝐇𝐄𝐀𝐑𝐓𝐒𝐇𝐀𝐊𝐄𝐑 ,, min ho (xo kitty) cover
ᴇʟʏꜱɪᴀɴ | BNHA cover
The Day We Met --》Min Ho cover
Naruto: Copy System cover
[Blue Archive] And Where All Hatred Begins cover
Masked Obsession cover

Lady of the Dark Mark | T.M.R

65 parts Ongoing

❝ ah, but it was not tom riddle who made the dark mark. ❞ dumbledore's eyes fogged over, a memory of the once-smart and cunning student entering his mind as he stroked his white beard. ❝ then who did, sir? ❞ harry potter stared at the headmaster, dumbfounded. ❝ tom riddle's one and only love: ravena. athena ravena malfoy. lady of the dark mark. ❞ ────୨ৎ──── ↳ in which the first generation of the death eaters rise to power, and the malfoy twins choose the dark. one chooses to lead alongside the dark lord, while the other chooses to be a follower. ── .✦ tom riddle x oc ── .✦ dark academia, academic rivals to lovers, found family, slowburn. ── .✦ tom riddle era + first wizarding war era + marauder's era + golden trio era | second wizarding war era - regular updates every friday -

More details