German Summon [ ENG Version ]
Mrs-Sirin
  • Reads 15,058
  • Votes 302
  • Parts 22
  • Time 2h 43m
  • Reads 15,058
  • Votes 302
  • Parts 22
  • Time 2h 43m
Mrs-Sirin
Ongoing, First published Mar 01
Mature
actionalthistoryenglishfantasygenshinimpactgermanywarwwii
In the sea region belonging to Mondstadt on the continent of Teyvat, a strange event occurred. A mysterious army from a powerful empire suddenly appeared and disrupted all peace across the continent.

Every land across Teyvat faced a great challenge as they confronted the threat from an unknown force known as the German Reich .

The question arises: Did they come with good intentions, or are they merely sowers of war and destruction?

Is there any way to interact with them peacefully, or will they be an unpredictable enemy?

Their appearance is not just a challenge but also concerns the existence and future of the entire continent of Teyvat!

Stay tuned for the tragedies or... Well, never mind... Enjoy!
Public Domain
actionalthistoryenglishfantasygenshinimpactgermanywarwwii
Table of contents

22 parts

Sign up to add German Summon [ ENG Version ] to your library and receive updates
or
Content Guidelines
You may also like
Genshin Impact: The Origins by zartan4500
43 parts Ongoing
Everything has an Origin.... This is story about Origin of Teyvat. Origin of everything. What really happened during Archon war and Khaenri'ah Cataclysm The Untold story about first true Descender This is the story about about forgotten lands and forgotten warriors The Origin of the Myths This is where everything begins and Where everything Ends The Beginning of the End also The End of the Beginning (I want to join to Hoyoverse as a screenwriter. So I decide to write this story. Wish me good luck and comment your thoughts about this story. and remember, this is not some stupid love story or fiction. This story will more accurate than Genshin Impact lore itself)
NEVER SPLIT THE PARTY: The Adventures of the Creeping Bam (BOOK 1: The Job) by BrenGrigori
31 parts Complete Mature
TAO is a broken world held together with nothing but magic and the will of the gods who protect it and its people. Ten thousand years ago THE SUNDERING struck and Tao was almost torn apart by a terrible magical cataclysm which resulted in the planet almost being halted in its journey through the cosmos. It took all the power the gods of Tao could muster to restore its orbit and set it turning again, but in their efforts it was forever changed - its axis was drastically altered, and it now spins in such a way that one face of the world is forever turned from the sun it orbits, leaving half the planet in perpetual darkness. The various humanoid races that survived and now thrive within the habitable parts of THE DAY LANDS have come to live in perpetual fear of what lives beyond THE BORDERLANDS that separate them from whatever dwells within THE NIGHT LANDS, but for ten millennia it has kept its secrets. The land of RUNDAO languishes under the rule of their warlike Northern neighbours, the TEKTEHRAN EMPIRE, while a small, ragtag band of motley adventurers ply their mercenary trade fighting monsters and protecting the common man from the various dangers that haunt the night and prowl the hinterlands on the edges of civilization. THE CREEPING BAM have amassed a modest reputation in their years together, but they're still just a small-time party of sellswords, thieves, outcasts and mages. They're also exactly the kind of underdogs the people of Tao doesn't yet realise are needed to save the world from the encroaching darkness they doesn't even know is coming ... IMPORTANT: Please note this story includes content that may be considered mature, such as moderate battle violence, some strong language and occasional mild sexual scenes. I am also serializing this on Tumblr, Sweek, Quotev and RoyalRoad.com
Reincarnated as an Adeptus by Mumei_Yume77
97 parts Ongoing
"There is no such thing as no way. As long as there is a possibility, then there is a way." That was what she told herself. Though she never believed in it, she lived by those principles only to have been shocked when the unexpected happened. A strange person has appeared out of nowhere. Claiming that he was a God from a video game. "I have a feeling that I'll get roped into something huge..." She mumbled to herself. Not knowing that her intuition was correct. A journey through the stars and into the vast world of Genshin Impact. One where history may rewrite itself. Or one where new beginnings will come true. On the path to seek redemption, she will walk along this thorny road. Hoping to accomplish and achieve something that was unreachable in her past life. (Cover art made by ✨me✨) - I do not own Genshin Impact -I own only my OCs
GATE: Thus NATO Fought There by Ant357627
44 parts Ongoing Mature
It'll be a crossover of GATE and Fallout. It'll be inspired by the book "GATE old world blues" by user444890.
Inazuma x Reader - Lost to Eternity by Obahar_
33 parts Ongoing
A gender neutral Y/N has ended up in Inazuma after ending up adrift at sea as a result of their fight with Osial. There is currently a civil war going on between those in control and those who refuse to lie down and lose everything in the name of Eternity. Due to the nature of your arrival, and your status as an individual it would seem profitable for either side to recruit you to their beliefs... but being an ignorant outsider, this would most likely just end up being the first side to make contact with you... I do not own any of the developed characters depicted in this story, nor Genshin Impact, the game of which the characters originate from.
𝙼𝚎𝚛𝚌𝚜𝚝𝚊𝚍𝚝: 𝙻𝚎𝚝 𝚝𝚑𝚎 𝚁𝙴𝙳 𝚃𝚎𝚊𝚖 𝙻𝚎𝚊𝚍! || (TF2 X Genshin) by kk_isok
8 parts Ongoing
When the Engineer tried making an advanced form of teleportation via Gateway portal, he accidentally connected it to the magical world of Teyvat; prompting the Mercenaries to survey their new discovery. Unbeknownst to them, their own rainbow-loving arsonist would manage to befriend a certain explosive-enthusiastic elf - forging an unexpected, but needed alliance with the Knights of Favonius. P.S. The characters are not made by me. They belong to their respective developers. Team Fortress 2 belongs to Valve and Genshin Impact belongs to Hoyoverse
Gate: Thus The Marines Fought There by I_Novelist_I
12 parts Ongoing
On an otherwise peaceful summer day in Tokyo, the tranquility of Ginza is shattered by a brutal attack, leaving thousands dead in the streets. In the aftermath, the question arises: who is responsible, and how should they be held to account? Initially believed to be a terrorist assault, the truth emerges that the assailants are legionnaires, Orks, and dragons emerging from a mysterious gate that has opened in Ginza, revealing a portal to a parallel world filled with fantastical creatures. With news of the incident spreading worldwide, Japan accepts assistance from the United States, who dispatch a brigade seized Marine Expeditionary Unit of 3,000 Marines aboard the USS Albright to aid in the response. DISCLAIMER: I do not own Gate nor the images I'm using. I'm writing this story based on the Anime, I never read the manga or the novel. The story will introduce certain additions to the lore and the world of Gate itself so don't throw rocks at me.
Genshin Impact: Our Worlds by Electroblade666
5 parts Ongoing
Teyvat has been overrun by the Abyss Order! The Traveler has been slain by his own twin, and the Seven Nations' mightiest heroes, Archons, and leaders have been driven into hiding. In a final, desperate bid for salvation, Teyvat harnesses the power of the fallen Traveler's Intertwined Fates to send a plea for help to another dimension: Earth. Now, it is up to the two worlds to unite against this overwhelming evil and restore peace to Teyvat.
Moonlit Bonds - A Story in Teyvat by Moon_Midnight21
27 parts Ongoing Mature
A Genshin Impact inspired story set in Teyvat that follows Twilight, a young, handsome, mischievous young man. Twilight, born half fox-kin, is considered an outcast because of his large fox ears in the city of Mondstadt. Known by the whole city for his mischievous and annoying pranks, he is constantly having the Acting Grand Master Jean breathing down his neck. After two men mysteriously showed up one day and took his mother away without a trace while he was younger, he dreams to become an adventurer to find her one day. During a chance encounter with a woman seeking a trade deal in Mondstadt, his life spins into an unforgettable journey. Will Twilight be able to fulfill his dreams of finding his mother? Will he find love? What kinds of secrets are behind closed doors? Read Moonlit Bonds today to find out!
Red Karma (Genshin Impact Fanfic) by siella_spring
18 parts Complete
Suffering from the death of her mother and betrayals, she became an Adeptus God and met the other Archons. After the war in Khaenriah that happened 500 years ago, Iris woke up and ventures the world as a fatui harbinger seeking answers from 500 years ago. in the process, she met them again, especially him. will she continue to search for her unanswered questions from 500 years ago? or just let the wind of fate guide her? ---- Genshin Impact fanfic story, if you like the story please leave a comment, like, and follow me for more updates~ (I don't own the cover photo, credits to the rightful owner!)
You may also like
Slide 1 of 10
Genshin Impact: The Origins cover
NEVER SPLIT THE PARTY: The Adventures of the Creeping Bam (BOOK 1: The Job) cover
Reincarnated as an Adeptus cover
GATE: Thus NATO Fought There cover
Inazuma x Reader - Lost to Eternity cover
𝙼𝚎𝚛𝚌𝚜𝚝𝚊𝚍𝚝: 𝙻𝚎𝚝 𝚝𝚑𝚎 𝚁𝙴𝙳 𝚃𝚎𝚊𝚖 𝙻𝚎𝚊𝚍! || (TF2 X Genshin) cover
Gate: Thus The Marines Fought There cover
Genshin Impact: Our Worlds cover
Moonlit Bonds - A Story in Teyvat cover
Red Karma (Genshin Impact Fanfic) cover

Genshin Impact: The Origins

43 parts Ongoing

Everything has an Origin.... This is story about Origin of Teyvat. Origin of everything. What really happened during Archon war and Khaenri'ah Cataclysm The Untold story about first true Descender This is the story about about forgotten lands and forgotten warriors The Origin of the Myths This is where everything begins and Where everything Ends The Beginning of the End also The End of the Beginning (I want to join to Hoyoverse as a screenwriter. So I decide to write this story. Wish me good luck and comment your thoughts about this story. and remember, this is not some stupid love story or fiction. This story will more accurate than Genshin Impact lore itself)

More details