WALLPAPER DINDING CUSTOM MIHRAB MAKKAH MALANG
wallpaper34
  • Reads 3
  • Votes 0
  • Parts 1
  • Time <5 mins
  • Reads 3
  • Votes 0
  • Parts 1
  • Time <5 mins
wallpaper34
Ongoing, First published Mar 25
dekorasidindinghiasandindinginteriorjasapasangwallpaperwallpapercantikwallpapercustomwallpaperdindingwallpapermalangidwallpapervinyl
Saat ini wallpaper dinding custom menjadi dekorasi rumah yang digemari oleh semua orang. Wallpaper dinding custom adalah dekorasi dinding yang terbuat dari kertas vinyl berkualitas yang desain dan motif nya bisa disesuaikan dengan keinginan dan kebutuhan Anda.

Bagi kamu yang ingin memasang wallpaper dinding custom di Malang, Wallpaper Malang ID hadir dengan menyediakan berbagai macam interior yang berkualitas salah satunya adalah wallpaper dinding. Wallpaper Malang ID juga menyediakan jasa pemasangan wallpaper dinding dengan harga terjangkau. 

Jika Anda tertarik untuk memasang wallpaper dinding custom atau menggunakan jasa pasang wallpaper dinding, segera hubungi Wallpaper Malang ID. Anda bisa berkonsultasi gratis secara online dan survey sebelum pemasangan, kami siap memberikan layanan terbaik untuk Anda.

Instagram: wallpapermalang.id
WhatsApp: 087803144655
Ingat rumah, ingat Wallpaper Malang ID
All Rights Reserved
dekorasidindinghiasandindinginteriorjasapasangwallpaperwallpapercantikwallpapercustomwallpaperdindingwallpapermalangidwallpapervinyl
Table of contents

1 part

Sign up to add WALLPAPER DINDING CUSTOM MIHRAB MAKKAH MALANG to your library and receive updates
or
#652interior
Content Guidelines
You may also like
Short Novel 18+ by Jeon_Lyheng_99
5 parts Complete
រោលរាល/ក្តៅសាច់/ស្រើបស្រាល/អាសអាភាស/🔞
𝐓𝐡𝐞 𝐔𝐧𝐛𝐫𝐞𝐚𝐤𝐚𝐛𝐥𝐞 𝐁𝐨𝐧𝐝 by 00_mafia_00
38 parts Ongoing
A story of four brothers whose life revolves around each other. Fate wasn't kind to them, but they were in it together, always have been and always will be. The eldest brother who is known to be a cold, arrogant and emotionless CEO can destroy the world for his younger brothers. Dare look at his brothers with any ill intention and he won't think twice before destroying the lives of those individuals. He has been a father figure to his brothers since the death of their parents in a car crash. When it comes to them he is a total softy and looks after their every need, but this doesn't mean that he won't discipline them if they are in the wrong. Will these brothers be able to maintain the unbreakable bond they have? When some secrets are revealed of the younger brother, will the trust remain the same between them? What has fate planned for them? Peep into the story of these brothers to know further about their lives...... 🫣
The Badass Mafia Queen: The rise of power by lynnmason586
73 parts Ongoing
Alissa Iris De León the daughter of both the Spanish and Italian Mafia. A week after she was born she was sent away from her 2 brothers to live with her father. Alexandro De León, Alissa's father and the leader of the 1st powerful mafia which is the 'Italian Mafia'. He is the most feared man in the world and is known to never show emotions. They call him the 'THE DEVIL'. You utter a word to him or even make a little mistake he won't hesitate to kill you. After 12 years of living with him she became a copy of him no she became even worse than him. On her 13th birthday she was sent back to live with her mother and brothers. 2yrs of living with them her mother was presumed to be 'dead' and they were sent to live with their uncles who were surprise surprise the leaders of the American Mafia.
His Birdy (18+) by hyjtyyy
24 parts Ongoing
This book is extremely dark. So I suggest you to think before reading Xavier Von Francino A Italian Mafia who is powerful and Most richest Billionaire in the country. He is 32 years old. Power, Money, Blood is all he need in his life until he meet her.. He will make her his no matter what. His obsession can't describe by word. He can't close his eyes for a minute. He want her closer to him so he married her forcefully. He will burn down the whole world if anyone try to hurt her. Only he can hurt his birdy. He is ruthless when it comes to his "BIRDY".He is controlling, possessive, Obsessed.. Grace Monovan A young beautiful girl who work hard for her life. She is strong, independent. she have no one as her parents died into a car accident when she was 8. A granny took care of her but she also died when she was 13.She is now 19 years old. Although she was happy with her life until she saw Xavier.. her biggest nightmare.she tried to escape but always end up in his cage again.. They are totally different.. what will happen when a Beast fall for his Angel.. his birdy. Will Grace ever able to escape him? or she have to suffer till death..? Note: I am only updating this book on Wattpad. Any uploads on other platforms are unauthorized and should be reported.
WOSO Oneshot by woso_wosolover
157 parts Ongoing
A WOSO Oneshot book Oneshots of favourite Women's footballers Mainly the Lionesses, Arsenal Women's team,Chelsea Women's team, Man City Women's team and Man Utd Women's team
Short Novel 18+ by Jeon_Lyheng_99
3 parts Complete
Taekook🔞
မောင့်ထိဂရ�ုံး!Horror! by ThuRa9220
22 parts Complete
"သွေး ဆိုတာ သူတို့နဲ့ ထိုက်တန်လို့ ကျသာပါမောင်" "ေသြး ဆိုတာ သူတို႔နဲ႕ ထိုက္တန္လို႔ က်သာပါေမာင္"
Indian short stories by Narrativenest
48 parts Ongoing
Collection of different Indian short stories.
🔞ហឹរ 2+3នាទី🥵🔥 by AgustRed0693
19 parts Ongoing
🗣️: បើមិនចូលចិត្ត ពាក្យពេចន៍មិនសមរម្យឬចំៗ សូមកុំចូលអាន [BL]🔥🔞🥵 Tae X +++ (S+E+X) [17.10.24]
GXG SMUT by star1ight09
6 parts Ongoing
These are GXG oneshots I've decided to write This book is kinky so if you're not comfortable with that.. im sorry this book isn't for you (G!P) [Intersex: A girl having a dick]
You may also like
Slide 1 of 10
Short Novel 18+ cover
𝐓𝐡𝐞 𝐔𝐧𝐛𝐫𝐞𝐚𝐤𝐚𝐛𝐥𝐞 𝐁𝐨𝐧𝐝 cover
The Badass Mafia Queen: The rise of power cover
His Birdy (18+) cover
WOSO Oneshot cover
Short Novel 18+ cover
မေ�ာင့်ထိဂရုံး!Horror! cover
Indian short stories cover
🔞ហឹរ 2+3នាទី🥵🔥 cover
GXG SMUT cover

Short Novel 18+

5 parts Complete

រោលរាល/ក្តៅសាច់/ស្រើបស្រាល/អាសអាភាស/🔞

More details