✨
ihavebugsinmybrain
  • Reads 318
  • Votes 0
  • Parts 8
  • Time 1h 29m
  • Reads 318
  • Votes 0
  • Parts 8
  • Time 1h 29m
ihavebugsinmybrain
Ongoing, First published May 21, 2024
abigailsdvelliotsdvemilysdvharveysdvmarniesdvmarusdvpennysdvsamsdvsdvsdvfanficsebastiansdvsebsdvsebxreaderselfinsertshanesdvstardewvalleystardewvalleyfanficstardewvalleysebastianstardewvalleyselfinsert
✨ (fem) farmer x seb  + other general sdv self insert✨

This definitely isn't me coping with how much I hate work and my Stardew Valley obsession.

Thanks for reading if you do :)

*Contains adult language and themes*
All Rights Reserved
abigailsdvelliotsdvemilysdvharveysdvmarniesdvmarusdvpennysdvsamsdvsdvsdvfanficsebastiansdvsebsdvsebxreaderselfinsertshanesdvstardewvalleystardewvalleyfanficstardewvalleysebastianstardewvalleyselfinsert
Table of contents

8 parts

Sign up to add ✨ to your library and receive updates
or
#45stardewvalley
Content Guidelines
You may also like
A New Beginning by Romanian-nugget
35 parts Complete Mature
Restarting in stardew valley, you have nothing from you past life except the clothes you came in and now you have to figure out what to do. You have the money to succeed but you need to put in the work. This is mainly just a slow burn*
monsters of stardew Valley (re write) by Romanian-nugget
14 parts Complete Mature
let's be honest the first one i made sucked dick and not in a fun way. this one lets hope will be better. Also please read the prolouge, it'll make more sense with that Not my art!
Stardew valleyx Male!reader by Romanian-nugget
36 parts Complete Mature
in this you get to pick the ending you want. There will be different endings so you can pick the S/O you want. The entire story will be the same for all of them until the last chapter where you choose who you want. MALE READER!!!!!! *i will finish this as quick as i can but it might take a while. It will also be very long, so that there is enough plot development between each character and y/n. Be ready for alot once you start **side note i see y'all coming in here only for the lemons. You h0rny bastards 😂
The New Farmer in Town (ShanexFemaleReader) by TheSassyButterfly
13 parts Ongoing Mature
Stardew Valley fanfic, need I say more?
WHY CHOOSE? - a stardew valley short story by oatmilkqueer
5 parts Complete Mature
just your typical "why choose?" fic with lots of mutual pining and tension. Elliott x Fem! Farmer/Harvey x Fem! Farmer/Elliott x Harvey x Fem! Farmer.
Missing Pieces by LydiaEverleigh
18 parts Complete Mature
[STARDEW VALLEY FANFICTION] Ever since I started at Joja, it seems like everything is pointless. I keep Grandpa's letter in my desk drawer, and everyday, I contemplate opening it, but I remember his words: "Don't open it until you are sure there is nothing else to keep you going." And this was it. The ridiculous "age wage" joja used to base payroll off of, was killing me. I was running down to my last bit of savings rapidly.
Stardew valley one shots by Battlekat213
48 parts Ongoing
Just some light hearted stardew valley story's! Disclaimer these are not my photos. I hope you guys enjoy! If you have any story Ideas please comment them or message me! I'd love to use all of your ideas!
What do you want? | Shane x Reader by beeplushiee
47 parts Ongoing Mature
Art in the cover by DuckyDrawsArt This is a story basically where Shane is Shane, and the farmer (Y/n) cares about him, and falls in love with him (: Enjoy! ⚠️TWs include depression, excessive drinking and suicide mentions/attempts (any other TWs will be in the chapters as well as the suicide attempt)⚠️
Addicted by MareeMean92
20 parts Complete Mature
Shane isn't a fuck up anymore. He's well on his way to recovery, but the Farmer is a whole other problem herself. What started as a drunk night with his best friend, has become a season's worth of discovering the woman he loves and her addictions and depression. *This story is finished *this story is also posted on AO3 Cover art by PrinceOfRedRoses
PenPals [Elliott SDV × F! Reader] COMPLETED by txtbxtch
10 parts Ongoing
A young woman in the big lonely city is desperate to find friends after the loss of her beloved grandfather. She finds herself signing up for a PenPal service through the local library to help dampen the stress of her big move to the valley to reestablish her grandfather's farm. What happens when the farmer finally meets her PenPal in person and is more than smitten? [Just a note: The cover is AI generated There will be minor detail adjustments to fit the story line such as possible out of sequence events and the existence of certain technology. In this story I'm writing Elliott how I imagine him to in a friendship/relationship. Of course he's still based off of the game, but I obviously did some reading between the lines 😁 Let me know if you'd like other Stardew characters, I can do [YN] format too, male or female. Thanks for reading]
You may also like
Slide 1 of 10
A New Beginning cover
monsters of stardew Valley (re write) cover
Stardew valleyx Male!reader cover
The New Farmer in Town (ShanexFemaleReader) cover
WHY CHOOSE? - a stardew valley short story cover
Missing Pieces cover
Stardew valley one shots cover
What do you want? | Shane x Reader cover
Addicted cover
PenPals [Elliott SDV × F! Reader] COMPLETED cover

A New Beginning

35 parts Complete Mature

Restarting in stardew valley, you have nothing from you past life except the clothes you came in and now you have to figure out what to do. You have the money to succeed but you need to put in the work. This is mainly just a slow burn*

More details