The Reluctant Witch of Willow Creek ( Book 1)
Makayla892125
  • Reads 47
  • Votes 2
  • Parts 20
  • Time 57m
  • Reads 47
  • Votes 2
  • Parts 20
  • Time 57m
Makayla892125
Complete, First published May 31, 2024
bloodlinesbloodmoonpackfamilysecretsledgendslegacywitch
( BOOK #1) In the quaint, whisper-thin town of Willow Creek, where secrets bloom like wildflowers and magic lingers in the morning mist, Luna Bellwether lives a life decidedly un-magical. Surrounded by her eccentric, spell-casting family, Luna prefers the comforting logic of library shelves and the predictability of her routines.  She dismisses her family's stories of ancient prophecies and mystical powers as charming folklore, content to leave the "witching" to them.

But fate, it seems, has other plans. 

When a life-altering event shakes Luna's world, a dormant power within her awakens, unleashing a torrent of unpredictable magic and forcing her to confront the truth about her heritage. Guided by her enigmatic grandmother, Esmeralda, Luna embarks on a journey of self-discovery, delving into the Bellweather family grimoire and uncovering generations of carefully guarded secrets. 

As Luna grapples with her newfound abilities, she uncovers a prophecy that entwines her destiny with the fate of Willow Creek itself.  She must learn to control her powers, facing down a rival witch family with a vendetta against the Bellwethers and navigating the complexities of a burgeoning romance with someone who challenges her skeptical heart. 

Filled with quirky townsfolk, charming familiars, and a touch of whimsical magic, "The Reluctant Witch of Willow Creek" is a story about embracing the unknown, discovering the power within, and finding magic in the most unexpected places.  But as Luna learns, magic comes with a price, and sometimes, the greatest battles are fought not with spells and potions, but with the courage to accept who you were always meant to be.
All Rights Reserved
bloodlinesbloodmoonpackfamilysecretsledgendslegacywitch
Table of contents

20 parts

Sign up to add The Reluctant Witch of Willow Creek ( Book 1) to your library and receive updates
or
#3ledgends
Content Guidelines
You may also like
The Malfoys by ilovechocolate64
120 parts Complete
Living in a pure blood family is tough and it only gets harder after attending Hogwarts . You're family is close friends with the malfoys whilst your close friends are what they would call blood traitors and mud bloods.The families attempts of maintaining the high status of their name only causes you pain and loss. How will you survive ???? Story starts of as an 11yo so if u don't want that you can skip to the chapter called quidditch 'World Cup' or 'the last da meeting' Y/n is in the year below Draco👍👍👍 hope you enjoy !! 1st in betrothed. 1st in pureblood
Book 4: The Blood Moon Eclipse by HaizyShah
11 parts Complete Mature
The Hidden Realm, once a sanctuary of peace, now teeters on the brink of chaos. The Blood Moon's return heralds a new era of darkness, and the whispers of the ancient ones speak of a looming threat, a reckoning yet to come. The Shadowborn, fueled by vengeance and led by a mysterious new figure, prepare to strike at the heart of Starlight, their sights set on the power that lies within. Anya, Silas, and Damien, their bond forged in the crucible of trials and betrayal, stand as the last line of defense. Anya, the witch of the blood moon, must confront her own inner demons and embrace the full extent of her power. Silas, the seasoned hunter, must grapple with the ghosts of his past and the sacrifices he has made in the name of redemption. And Damien, the conflicted vampire, must choose between the love that binds him to Anya and the darkness that calls to his bloodline. Their journey will lead them to forgotten realms, ancient battlegrounds, and the very heart of the Shadowborn's domain. They will face trials that test their courage, their loyalty, and the very essence of their being. They will encounter allies and enemies, both old and new, and forge alliances that will shape the destiny of their world. As the Blood Moon's Eclipse casts its ominous shadow, a new generation of heroes will rise, their destinies intertwined with the fate of two worlds. The battle for the future has begun.
Bloodlines of Destiny by xxGuccixx
19 parts Complete
In a world where shadows hold secrets and supernatural beings lurk just beyond the veil of reality, Anne thought she was just a normal girl haunted by the tragic loss of her parents. But when a fateful encounter reveals the truth about her lineage, everything she thought she knew crumbles away. As the only child of a powerful witch and a noble vampire, Anne discovers she is a hybrid with extraordinary abilities-and a destiny she never asked for. But her parents' mysterious deaths were no accident; they were murdered by a ruthless vampire lord determined to reignite the age-old war between the supernatural factions. With the help of her loyal friends, Lisa and Alex, Anne embarks on a perilous journey to uncover the truth behind her parents' deaths and unlock the powers she possesses. As she trains to harness her magic, Anne learns that trust is a fragile thing, especially when her connection to the enigmatic werewolf, Christian, pulls her in two directions-toward danger and a bond she never expected. As dark forces gather and the lines between friend and foe blur, Anne must confront her deepest fears and embrace the legacy she inherited. Will she rise to protect those she loves, or will she fall victim to the very darkness she seeks to combat? "Bloodlines of Destiny" is a spellbinding tale of love, loss, and self-discovery, woven with intrigue and suspense. Join Anne as she navigates a world filled with danger and desire, where every choice could alter the fate of both her family and the supernatural realm forever. I've been writing this book since a long time ago and now I've build up the courage to share it with you guys I hope you like it A NEW CHAPTER EVERYDAY !!!
Bewitching the Beast by skybye1
29 parts Complete Mature
He is a powerful Alpha and she is a powerful witch. He is troubled and had to watch over his family and pack from a young age. She endure a dark past and works hard to help everyone else while trying to hold it all together. What happens when the fates puts them together as mates when they don't realize that one another kinds exist? Being the oldest of ten, Nathan Reynolds is the Alpha of the Hidden Moonstone Pack and the legal guardian of his seven younger siblings; all under the age of sixteen. Taking over for his parents after their untimely death three years prior; Nathan has a lot on his plate and is slowly breaking apart. When his brothers, who are his Beta and Third in Command, Jonah and Donnie, hire a nanny without his permission; he doesn't know what to make of the younger southern woman who has charmed his entire family. Ainsley Bennett seems to be a normal human woman working as a nanny, but in reality she is a high power witch with a haunting past. Taking the job at the Reynolds' household, Ainsley helps open up the family in only a day, but when Nathan finds her at his dinning table, he is pissed and doesn't want an outsider invading his home. Will she be able to convince him that his family needs her and will she be able to keep the walls up that she was built around her heart? In the end will the witch tame the wild beast or will the beast heal her break heart? Both Ainsley and Nathan are on a journey that will forever change their lives and they don't know if it will be for the best or worst.
Witchcraft and Wolfsbane by DaniDraven
20 parts Complete Mature
When witch Bella's visions of blood and horror reveal a dark secret in her coven's past, she is torn between saving those who have scorned her and sacrificing the enticing werewolf who accepts her. *** As a descendent of the cursed Black family, Belladonna is the scourge of her coven. And after jilting the Elder's son at the altar her place as the lowest of the low is secured. But when her desperate coven makes a deal to share their land with the infamous BloodFrost pack, Bella is thrown into the path of notorious alpha Cain. Bella discovers he may be the key to breaking the curse that has stripped her coven of their powers for centuries. And when she catches his eye, may finally have found a way of pleasing those who have rejected her. But as Bella finds passion and solace in the arms of the man she is betraying, she is plagued by violent visions of the past, forcing her to confront the dark truth about her nature and the devastating origins of the curse.
Blood Moon Pack by booktrovert19
16 parts Complete Mature
In a world ruled by pack laws and ancient bonds, Chelsea's life is torn apart when her entire pack is slaughtered, and the man responsible is none other than Alpha Owen-her fated mate. Thrust into a nightmare of loss and betrayal, Chelsea is forced to confront the devastating truth of her destiny. Chelsea's journey is one of survival and resilience as she navigates a new life under the roof of the man who destroyed everything she held dear. Alpha Owen, feared and revered, is a powerful leader with a dark past. Despite the bloodshed that binds them, an unbreakable bond and undeniable chemistry pull them together. As Chelsea struggles to reconcile her hatred with the mate bond, she discovers layers to Owen that she never expected. Together, they face enemies old and new, uncovering secrets that threaten to tear their fragile world apart. The birth of their son, Colden, with his striking red eyes, only adds to the complexity of their relationship, marking the beginning of a new era for their pack. Caught between love and duty, Chelsea must navigate the treacherous waters of pack politics, ancient curses, and her own tumultuous emotions. Can she forgive the man who caused her so much pain? Can they unite to protect their future and their pack from looming threats? Join Chelsea and Owen in a gripping tale of love, loss, and redemption. In a world where fate is as cruel as it is binding, Chelsea's strength and spirit are the keys to forging a path toward healing and unity. This is a story of how even the deepest wounds can be healed by the power of love and the bonds that tie us together.
The Reluctant Witch of Willow Creek: The Heartwood's Blood (book4) by Makayla892125
30 parts Complete
The Reluctant Witch of Willow Creek: The Heartwood's Blood "Blood will be spilled. Ancient bonds will be tested." A chilling discovery rocks the usually tranquil Willow Creek. A ritualistic symbol, etched in blood and echoing with dark magic, is found carved into the heartwood's oldest oak. Fear grips the village, for this is no act of mischief, but a chilling omen of a power thought long dormant. The symbol is one Luna recognizes with a shudder - a mark of the Blood Coven, a group of magic practitioners who once sought to bend the heartwood to their will, leaving a trail of pain and destruction in their wake. Believed to be extinct for generations, their reappearance threatens to unravel the very fabric of Willow Creek, and this time, they seek something far more sinister: a power buried deep within the heartwood, fueled by the life force of magic itself. As the heartwood bleeds, so too does the line between the human and magical worlds. Luna, along with Liam and a growing alliance of allies both human and mystical, must race against time to decipher the coven's true intentions and stop them before their thirst for power consumes everything Luna holds dear. "The Heartwood's Blood" is a gripping tale of ancient grudges, the intoxicating lure of forbidden magic, and the sacrifices demanded in the name of love and loyalty." Prepare to be swept away on a thrilling journey into the heart of a brewing storm, where the fate of Willow Creek hangs in the balance, and the heartwood itself cries out for vengeance.
The Reluctant Witch of Willow Creek: The Rowan's Curse (book 5) by Makayla892125
29 parts Complete
The Reluctant Witch of Willow Creek: The Rowan's Curse "Luna never wanted to be a witch." She inherited her magic from her grandmother, but all she desires is a simple life in their peaceful village of Willow Creek. But when a dark magic settles over the heartwood, a place of ancient power intertwined with her family's legacy, Luna is forced to confront her destiny. A withered harvest, strange illnesses, and whispers of a malevolent presence haunt the villagers. The source? A curse tied to the mystical rowan tree, its magic twisted and corrupted. To save her home and the people she loves, Luna must unravel the secrets of the curse, confront her own burgeoning powers, and face a choice that will forever alter the fate of Willow Creek. Along the way, she finds an unlikely ally in Liam, her childhood best friend, whose connection to the heartwood runs as deep as her own. But their bond is tested as the curse weaves its dark magic, threatening to consume everything they hold dear. "The Reluctant Witch of Willow Creek" is a tale of self-discovery, sacrifice, and the enduring power of love and friendship in the face of darkness." It's a story for anyone who has ever felt the call of the unknown, the pull of their own hidden strength, and the courage to embrace their true destiny.
A Study of Poisons by ArsonistDiary
35 parts Complete Mature
A STUDY OF POISONS BOOK 1 (CURRENTLY BEING EDITED AND REVAMPED) _____ Vampires are ruthless and should be eradicated- that is the old way. However, in the modern world, tradition still finds its way around us. Cordelia Greerson was raised to be a Keeper, one of the many humans who study the art of magic to protect humanity from Vampires and Witches. Her entire life has been devoted to the art of protecting the two split worlds. Making sure they never collide. To her, only one thing matters- Order before blood. After the Vampiric Queen is nearly assassinated, it becomes Delia's next mission to protect the Heir at all costs in the hills of Scotland. With thick blooded hatred, Delia must find out who is threatening the Prince all while keeping a close eye on him for the Keepers. However, soon conflict battles in her heart as she finds herself seeing the edge of the line of the Vampiric world- and the Prince's heart. (CURRENTLY BEING REVIEWED FOR EDITING) ______ This is a job, save the Vampire Prince and play the spy for the Order of the Sword. This should be easy- I was raised to do this... but he's not like the others. None of them are. I am Cordelia Greerson, I am a Keeper. ______ #23 in Vampireromance #1 in Magis #1 in Vampette #14 in Paranormal #31 in Magic #1 in Supernatural #22 in Vampire #3 in Court ______
The New Alpha by Madi_phelps123
36 parts Complete Mature
Everly is a werewolf living in a pack where no one wants her. Her mother and father don't treat her the same as her beautiful sister. She has learned to get used to their unfairness towards her. Her sister, Victoria, humiliates her in school, at home, around her parents, and the whole pack thinks she's a weak link. But no one can take away how she feels when she runs in wolf form. Something only her mother and father know about her is she's a black wolf, the only known female black wolf in existence. She doesn't think anything of it, in fact it's something her mother and father hate about her the most. She can't wait to find her mate and just get away from her pack and family. When their pack alpha dies a new one comes in, Maddox, one of the most feared Alphas. When he comes to the new pack he instantly starts showing Everly some confusing attention. She doesn't know whether he likes or hates her. But what happens when her eighteenth birthday rolls around? The day she's supposed to finally know who her mate is....or isn't. Secrets start to unveil themselves causing trouble not only with Everly and Maddox but also with her family and the surrounding packs. Find out what happens when situations occur and they try to figure out how to fix it...and fast. Number 1 in #Werewolf- 2020 -if you're triggered easily don't read. The plot twist isn't for everyone.
You may also like
Slide 1 of 10
The Malfoys cover
Book 4: The Blood Moon Eclipse cover
Bloodlines of Destiny cover
Bewitching the Beast cover
Witchcraft and Wolfsbane cover
Blood Moon Pack cover
The Reluctant Witch of Willow Creek: The Heartwood's Blood (book4) cover
The Reluctant Witch of Willow Creek: The Rowan's Curse (book 5) cover
A Study of Poisons cover
The New Alpha cover

The Malfoys

120 parts Complete

Living in a pure blood family is tough and it only gets harder after attending Hogwarts . You're family is close friends with the malfoys whilst your close friends are what they would call blood traitors and mud bloods.The families attempts of maintaining the high status of their name only causes you pain and loss. How will you survive ???? Story starts of as an 11yo so if u don't want that you can skip to the chapter called quidditch 'World Cup' or 'the last da meeting' Y/n is in the year below Draco👍👍👍 hope you enjoy !! 1st in betrothed. 1st in pureblood

More details