DISTRIBUTOR WALLPAPER VINYL ROLL WARNA PUTIH
jasawp39
  • Reads 1
  • Votes 0
  • Parts 1
  • Time <5 mins
  • Reads 1
  • Votes 0
  • Parts 1
  • Time <5 mins
jasawp39
Ongoing, First published Jun 10, 2024
distributorwallpaperjasapasangwallpaperdindingwallpapermalangidwallpapervinyl
DISTRIBUTOR WALLPAPER VINYL ROLL WARNA PUTIH

Ingin ruangan yang yang minimalis dan elegan? wallpaper vinyl roll warna putih bisa menjadi solusi untuk kamu. Wallpaper vinyl merupakan dekorasi dinding yang memiliki berbagai warna, motif, dan tekstur yang bisa kamu pilih untuk mendekorasi ruangan kamu. Tertarik untuk memasang wallpaper vinyl roll warna putih di ruangan kamu?, Wallpaper Malang ID adalah jawabannya.

Wallpaper Malang ID merupakan distributor wallpaper dinding berkualitas. Jika kamu tertarik dengan produk wallpaper vinyl roll warna putih dari Wallpaper Malang ID, berikut rinciannya.

Tipe Produk : Wallpaper Vinyl
Harga paket : 190rb-290rb
Bahan : Vinyl
Ukuran: 50cm x 950cm
Jasa pemasangan : 45rb-65rb

Jika kamu khawatir dengan hasil pemasangan yang tidak sesuai, Wallpaper Malang ID menyediakan jasa pemasangan dengan pekerja profesional dan berpengalaman sehingga hasil pasangnya tidak perlu diragukan lagi. Selain itu layanan konsultasi online secara gratis dan survey lokasi sebelum pemasangan juga tersedia untuk mengatasi rasa khawatirmu.

Tunggu apa lagi? ayo segera percantik ruanganmu dengan wallpaper vinyl roll dari Wallpaper Malang ID!
WhatsApp: 087803144655
Instagram: @wallpapermalang.id
Ingat rumah, ingat Wallpaper Malang ID
All Rights Reserved
distributorwallpaperjasapasangwallpaperdindingwallpapermalangidwallpapervinyl
Table of contents

1 part

Sign up to add DISTRIBUTOR WALLPAPER VINYL ROLL WARNA PUTIH to your library and receive updates
or
#39jasapasang
Content Guidelines
You may also like
𝙲𝚑𝚊𝚗𝚐𝚎 𝕋𝕙𝕖 𝘚𝘱𝘳𝘪𝘵𝘪 ᵒᶠ 𝔏𝔬𝔳𝔢 ʰᵉᵉʰᵒᵒⁿ ប្ដូរវិញ្ញាណចាប់ស្នែហ៍ by sunsun_bl
43 parts Ongoing
រឿងរ៉ាវបែបមិនធម្មតាមួយ ពីក្មេងដែលគេត្រូវគេធ្វើបាបប្រែក្លាយជាអ្នកប្រុសដែលមានអំណាចកាចមិនធម្មតា វាជាការប្ដូរវិញ្ញាណមួយចូលខ្លួនមួយទៀត ហួយ៎ ក៏ប្រែតែគេត្រូវបានដាក់ឈ្មោះថាជា omega តែប៉ុណ្ណោះ ប៉ុន្តែការដែលមានភេទជា omega គឺតែងតែត្រូវគេមើលងាយជានិច្ចព្រោះទន់ខ្សោយ តើនឹងមានរឿងអ្វីកើតឡើងក្រោយ omega តូចប្ដូរវិញ្ញាណហើយ គេបានជួបជាមួយ Mafia ម្នាក់នោះ...ហើយMafia ម្នាក់នោះជាមិត្តកាលគេនៅនឹងរាងកាយចាស់
Doctor Husband (Complete) by khatKhat396
40 parts Ongoing
စိုင်းတည်တံ့ဉီး + နှိုင်းမြတ်ဘုန်း
Trapped in my own head by WildImaginations16
140 parts Ongoing
She is an outcast. She finds it easier to express what she feels in the form of writing. Whether it is poems, letters or long texts. These are poems that she writes trying to describe how it feels to live with certain mental health issues, in a world that disregards outcasts. So, these are on the darker side of the spectrum. Some poems might be distressing for some readers. I personally enjoy consuming dark content, it's kinda like a coping mechanism. I really hope none of you relate with any of these :) I'll be posting only poems here, I'll try to be as active as I can. The poems are not in any order. They are just the thoughts that pop up any time of the day. (8.11.2023) PS: Please check out 'safe space'. I need your help to make it a real safe space, readers! Ranking: #1 shortpoem #1 distressing #1 poetry (17.1.2024) #1 poem (24.1.2024)
My Poetry by A_Shy_Person27
184 parts Ongoing
Most of this is sad, any TW will be at the start of them I'm a 17 y/o just wanting to share some of my poetry with people other than my friends :] (Also feel free to comment any tips and how I could improve on my writing!)
Poems And Some Deep Thoughts by affkff
90 parts Ongoing
"Writing feels better than speaking" The pictures I used in this book are not mine. Credits to the respective owners... #1 in poetry - 15/1/ 2025 #1 in thoughtsandfeelings - 16/1/2025 #1 in deepthoughts - 24/1/2025 #4 in advice - 25/1/2025 #1 in freeverse - 21/05/2022 #1 in poetrycollection - 26/05/2022 #1 in poembook - 22/05/2022 #1 in deeppoetry - 21/05/2022 #1 in deepshit - 21/05/2022 #1 in deeppoems - 10/07/2022 #3 in poet - 26/05/2022 #1 in cinquain - 27/05/2022 #1 in haiku - 22/06/2022 #1 in thought-provoking - 31/05/2022
One Shots Male Reader [||][Pedidos Cerrados] by Camcam-cam
173 parts Ongoing
Holaa~ Bienvenidos todos a estas pequeñas historias, empezando de nuevo :D Muchas gracias por pasarte por aquí, supongo que pronto voy a abrir los pedidos. Así que puedes disfrutar mientras tanto las historias que tengo ahora, puedes leer las aclaraciones o las etiquetas para saber que anime o de que escribo. Gracias &lt;3! Créditos a quien corresponda por todos los personajes utilizados, a excepción de _______.
A Dreamer's Poetry by TheZonlichtHeart
33 parts Ongoing
This book holds poems woven from dreams, a tapestry of fantasy and obsession, daring to explore the depths of my emotions beyond mere definition. ˚❀　.　˚　　✦　　✿　.　˚　. 　 ˚　✿.　˚　　❀ .　˚✦　.  ✿ 　　˚　　 ❀　　*　˚　 　❀　✦　˚ . For me every soul has a simple story, one that unfolds directly. But when it comes to poems, they transcend the ordinary. They are profound, open to interpretation, deciphered through the unique lens of your own perception. ⋆｡˚ ☁︎ ˚｡⋆｡˚☽˚｡⋆✩₊˚.⋆☾⋆⁺₊✧ Soo..shall we uncover the magic within these pages, together exploring the spectrum of emotions and the captivating landscapes of fantasy? Umm..I'll take it as yes (*≧∀≦*) N PLS DON'T MIND MY DESCRIPTION M REALLY NOT GOOD AT IT (￣▽￣) ◇Used Pictures are not mine ◇Source: pinterest ♡So picture CREDIT goes to the rightful Author*
𝐦𝐞𝐥𝐚𝐧𝐜𝐡𝐨𝐥𝐲 ➙ 𝘱𝘰𝘦𝘵𝘳𝘺 by MayGarner
99 parts Ongoing
MELANCHOLY | Melancholy drips from my fingertips. SOON TO BE A PUBLISHED PAPERBACK. COMING 2025! This melancholy drips from my fingertips so slowly, you begin to forget I even exist. All of me, the hard parts of flesh you could never seem to love, drips down the drain. I am waiting for the day for your fingers to unscrew the pipes, dig through debris and mess, scrape your heart against the rust, just to find me, so we can go through it all over again. Here, in the pages I find myself, in the ink that writes against my flesh, I will whisper the sadness, the heartache, and the decaying for all of the unspoken. Perhaps under this layer of melancholy, the girl I once knew still exists.    First poetry collection in the series. Original poems based off real life experiences. #12 in poetry. Cover template made by @KaleidoGraphix on Canva. 𝑴𝒆𝒍𝒂𝒏𝒄𝒉𝒐𝒍𝒚 copyright © May Garner. 2017. All Rights Reserved.
ياقلب دقات الهوى لاعبتني قامت تمايل بالدلع كانه العود by jjjl1i
30 parts Ongoing
الراويه : أم التوق ✍🏻 • • روايه سعوديه🇸🇦 « نقل روايتي واقتباسها يعرضك لمسائله قانونيه » اللهم بلغت اللهم فاشهد • • Instagram : jjjl1i
last ~ poetry by Ajay-Kumar
60 parts Ongoing
~ are these the last ones / or the ones that'll last? ~
You may also like
Slide 1 of 10
𝙲𝚑𝚊𝚗𝚐𝚎 𝕋𝕙𝕖 𝘚𝘱𝘳𝘪𝘵𝘪 ᵒᶠ 𝔏𝔬𝔳𝔢 ʰᵉᵉʰᵒᵒⁿ ប្ដូរវិញ្ញាណចាប់ស្នែហ៍ cover
Doctor Husband (Complete) cover
Trapped in my own head cover
My Poetry cover
Poems And Some Deep Thoughts cover
One Shots Male Reader [||][Pedidos Cerrados] cover
A Dreamer's Poetry cover
𝐦𝐞𝐥𝐚𝐧𝐜𝐡𝐨𝐥𝐲 ➙ 𝘱𝘰𝘦𝘵𝘳𝘺 cover
ياقلب دقات الهوى لاعبتني قامت تمايل بالدلع كانه العود cover
last ~ poetry cover

𝙲𝚑𝚊𝚗𝚐𝚎 𝕋𝕙𝕖 𝘚𝘱𝘳𝘪𝘵𝘪 ᵒᶠ 𝔏𝔬𝔳𝔢 ʰᵉᵉʰᵒᵒⁿ ប្ដូរវិញ្ញាណចាប់ស្នែហ៍

43 parts Ongoing

រឿងរ៉ាវបែបមិនធម្មតាមួយ ពីក្មេងដែលគេត្រូវគេធ្វើបាបប្រែក្លាយជាអ្នកប្រុសដែលមានអំណាចកាចមិនធម្មតា វាជាការប្ដូរវិញ្ញាណមួយចូលខ្លួនមួយទៀត ហួយ៎ ក៏ប្រែតែគេត្រូវបានដាក់ឈ្មោះថាជា omega តែប៉ុណ្ណោះ ប៉ុន្តែការដែលមានភេទជា omega គឺតែងតែត្រូវគេមើលងាយជានិច្ចព្រោះទន់ខ្សោយ តើនឹងមានរឿងអ្វីកើតឡើងក្រោយ omega តូចប្ដូរវិញ្ញាណហើយ គេបានជួបជាមួយ Mafia ម្នាក់នោះ...ហើយMafia ម្នាក់នោះជាមិត្តកាលគេនៅនឹងរាងកាយចាស់

More details