JASA PASANG WALLPAPER VINYL DI AREA MALANG
jasawp39
  • Reads 2
  • Votes 0
  • Parts 1
  • Time <5 mins
  • Reads 2
  • Votes 0
  • Parts 1
  • Time <5 mins
jasawp39
Ongoing, First published Jun 13, 2024
jasapasangwallpaperdindingwallpapermalangidwallpaperminimaliswallpapervinyl
JASA PASANG WALLPAPER VINYL DI AREA MALANG

Ruangan yang indah dan minimalis sudah menjadi populer di masa sekarang, dan kamu bisa mewujudkan ruangan seperti itu dalam waktu singkat menggunakan wallpaper dinding vinyl. Wallpaper dinding vinyl merupakan dekorasi dinding yang populer karena memiliki motif dan warna yang beragam. Jika kamu ingin memasang wallpaper dinding vinyl di rumah kamu Wallpaper Malang ID adalah solusinya.

Wallpaper Malang ID adalah penyedia jasa pasang wallpaper vinyl di area Malang, produk wallpaper vinyl yang tersedia dibuat dengan bahan berkualitas sehingga wallpaper tidak mudah rusak. Jika kamu tertarik dengan produk wallpaper vinyl dari Wallpaper Malang ID, berikut adalah rinciannya.

Tipe Produk : Wallpaper Vinyl
Harga paket : 190rb-290rb
Bahan : Vinyl
Ukuran: 50cm x 950cm
Jasa pemasangan : 45rb-65rb

Kamu khawatir dengan hasil pemasangan yang kurang rapi? tenang, jasa pemasangan wallpaper dari Wallpaper Malang ID dilakukan oleh pekerja profesional sehingga hasil pasangnya tidak perlu diragukan lagi. Selain itu layanan konsultasi gratis secara online dan layanan survey lokasi sebelum pemasangan juga tersedia untuk mengatasi rasa khawatir kamu!

Tunggu apa lagi? ayo segera percantik ruanganmu dengan wallpaper vinyl dari Wallpaper Malang ID!
WhatsApp: 087803144655
Instagram: @wallpapermalang.id
Ingat rumah, ingat Wallpaper Malang ID
All Rights Reserved
jasapasangwallpaperdindingwallpapermalangidwallpaperminimaliswallpapervinyl
Table of contents

1 part

Sign up to add JASA PASANG WALLPAPER VINYL DI AREA MALANG to your library and receive updates
or
#16jasapasang
Content Guidelines
You may also like
The Virus Within: The Unranked (Book 4) by CrystalScherer
50 parts Complete
Season 4 of The Virus Within Trinity is familiar with zombies, being one herself, but when strange zombies start appearing, she realizes that the world she knew might be changing yet again. When a dangerous set of scientific notes are discovered, Trinity and her friends don't realize anything is wrong until a frantic radio call comes in. Unaware of the notes, they race to the south and struggle to determine where the strange zombies came from. The zombies are unlike any ranks previously seen, and they aren't as predictable. Some have new tricks hidden up sleeves, forcing any Stronghold they encounter to quickly adapt to the new challenge or risk being overrun. Secrets never remain hidden, and zombie apocalypses never make life easy.
You may also like
Slide 1 of 1
The Virus Within: The Unranked (Book 4) cover

The Virus Within: The Unranked (Book 4)

50 parts Complete

Season 4 of The Virus Within Trinity is familiar with zombies, being one herself, but when strange zombies start appearing, she realizes that the world she knew might be changing yet again. When a dangerous set of scientific notes are discovered, Trinity and her friends don't realize anything is wrong until a frantic radio call comes in. Unaware of the notes, they race to the south and struggle to determine where the strange zombies came from. The zombies are unlike any ranks previously seen, and they aren't as predictable. Some have new tricks hidden up sleeves, forcing any Stronghold they encounter to quickly adapt to the new challenge or risk being overrun. Secrets never remain hidden, and zombie apocalypses never make life easy.

More details