PENYEDIA WALLPAPER VINYL WARNA ABU-ABU DIMALANG
jasawp39
  • Reads 1
  • Votes 0
  • Parts 1
  • Time <5 mins
  • Reads 1
  • Votes 0
  • Parts 1
  • Time <5 mins
jasawp39
Ongoing, First published Jun 20, 2024
jasapasangpenyediawallpaperwallpaperdindingwallpapermalangidwallpapervinyl
PENYEDIA WALLPAPER VINYL WARNA ABU-ABU DIMALANG

Di masa modern seperti sekarang mendekorasi rumah agar terlihat cantik sudah bukan hal sulit, solusinya adalah dengan mendekorasi ruangan menggunakan wallpaper vinyl warna abu-abu. Wallpaper vinyl merupakan dekorasi rumah yang populer karena memiliki warna dan motif yang beragam, selain itu wallpaper dinding juga bisa dipasang dengan cepat dibandingkan dengan cat dinding. Jika kamu ingin memasang wallpaper vinyl warna abu-abu di rumah kamu, Wallpaper Malang ID adalah jawabannya. 

Wallpaper Malang ID merupakan penyedia wallpaper vinyl warna abu-abu dimalang. Produk yang tersedia dari Wallpaper Malang ID merupakan produk berkualitas dan tidak mudah rusak. Jika kamu tertarik dengan wallpaper dinding dari Wallpaper Malang ID, berikut rinciannya.

Tipe Produk : Wallpaper Vinyl
Harga paket : 190rb-290rb
Bahan : Vinyl
Ukuran: 50cm x 950cm
Jasa pemasangan : 45rb-65rb

Kamu khawatir dengan hasil pemasangan yang kurang rapi? tenang, jasa pemasangan wallpaper dari Wallpaper Malang ID dilakukan oleh pekerja profesional sehingga hasil pasangnya tidak perlu diragukan lagi. Selain itu layanan konsultasi gratis secara online dan layanan survey lokasi sebelum pemasangan juga tersedia untuk mengatasi rasa khawatir kamu!

Tunggu apa lagi? ayo segera percantik ruanganmu dengan wallpaper vinyl warna abu-abu dari Wallpaper Malang ID!
WhatsApp: 087803144655
Instagram: @wallpapermalang.id
Ingat rumah, ingat Wallpaper Malang ID
All Rights Reserved
jasapasangpenyediawallpaperwallpaperdindingwallpapermalangidwallpapervinyl
Table of contents

1 part

Sign up to add PENYEDIA WALLPAPER VINYL WARNA ABU-ABU DIMALANG to your library and receive updates
or
#8wallpapermalangid
Content Guidelines
You may also like
The Virus Within: The Unranked (Book 4) by CrystalScherer
50 parts Complete
Season 4 of The Virus Within Trinity is familiar with zombies, being one herself, but when strange zombies start appearing, she realizes that the world she knew might be changing yet again. When a dangerous set of scientific notes are discovered, Trinity and her friends don't realize anything is wrong until a frantic radio call comes in. Unaware of the notes, they race to the south and struggle to determine where the strange zombies came from. The zombies are unlike any ranks previously seen, and they aren't as predictable. Some have new tricks hidden up sleeves, forcing any Stronghold they encounter to quickly adapt to the new challenge or risk being overrun. Secrets never remain hidden, and zombie apocalypses never make life easy.
You may also like
Slide 1 of 1
The Virus Within: The Unranked (Book 4) cover

The Virus Within: The Unranked (Book 4)

50 parts Complete

Season 4 of The Virus Within Trinity is familiar with zombies, being one herself, but when strange zombies start appearing, she realizes that the world she knew might be changing yet again. When a dangerous set of scientific notes are discovered, Trinity and her friends don't realize anything is wrong until a frantic radio call comes in. Unaware of the notes, they race to the south and struggle to determine where the strange zombies came from. The zombies are unlike any ranks previously seen, and they aren't as predictable. Some have new tricks hidden up sleeves, forcing any Stronghold they encounter to quickly adapt to the new challenge or risk being overrun. Secrets never remain hidden, and zombie apocalypses never make life easy.

More details