Dyskretny Urok Smoków
RinV_Urrathi
  • Reads 3,904
  • Votes 408
  • Parts 43
  • Reads 3,904
  • Votes 408
  • Parts 43
RinV_Urrathi
Complete, First published Jun 29
-romancebogowiedragondragonridersdragonsdwarveselfelfyelvesepicfantasyepickiefantastykafantasyfantasy-romancehighfantasyjeźdźcykrasnoludyorkiorksoryginalnapisarskiwattpadsilvsmoksmokiwampiry
Witaj w Bern, grodzie Pani, jednym z trzech najstarszych miast świata, stolicy Cesarstwa Zachodu! Stąd nikt nie powraca takim, jakim był. Tu każdy dzień pobytu obnaża zew, który niełatwo ukoić... 
Co położysz na szali, 
by zagrać w  grę pragnień, 
w domu Trafu, Losu, Piękna i Sztuki?
Miłość? 
Wolną Wolę? 
Dzikość Serca? 
Wyznanie?
Co jesteś gotów poświęcić, 
by postawić na swoim?
I czy nie ograłeś się sam? 
W karnawałowym amoku, 
zwiedziony urokiem smoków...

Poznaj siłę boskiej determinacji, która nie cofa się przed niczym.
All Rights Reserved
-romancebogowiedragondragonridersdragonsdwarveselfelfyelvesepicfantasyepickiefantastykafantasyfantasy-romancehighfantasyjeźdźcykrasnoludyorkiorksoryginalnapisarskiwattpadsilvsmoksmokiwampiry
Table of contents

43 parts

Sign up to add Dyskretny Urok Smoków to your library and receive updates
or
#1elves
Content Guidelines
You may also like
Zrozumieć miłość by Majcia1015
37 parts Complete
"Miłość sama w sobie jest nie do pojęcia, ale dzięki miłości możemy pojąć wszystko..." Lairiel za wszelką cenę chce naprawić błędy z przeszłości i zrekompensować krasnoludom doznane przykrości ze strony jej ludzi. Nie spodziewała się jednak, że Gandalf znajdzie rozwiązanie jej problemu w taki sposób. Lairiel kryje w sobie wiele tajemnic, których nie jest gotowa wyjawić kompanii. Czy wśród swoich towarzyszy znajdzie kogoś, kto myślałby jak ona i potrafił ją zrozumieć...?
What if Cale turned into a child? (Trash of the Count's Family Fanfiction) by ladyshannn
52 parts Ongoing
Cale turned into a child? Update: March 21, 2024 - UNDER REVISION
Claimed By Darkness by milkteawithmimi
33 parts Complete
By the age of sixteen, all elves are claimed by one of the six Gods and inherit some of their abilities. There is Aria (air), Lionel (earth), Kalama (fire), Beck (water), Gianna (mind), and Kai (dreams). Sorry, I seem to have left out one of the Gods, the most powerful God. Caspian, the God of darkness and death. He is the outsider, the most feared and dangerous God. Only two people have ever been claimed by Caspian, and they were both driven to insanity. Odette Parks was finally going to the academy to be claimed and learn to control her new powers. But instead of a fun high school experience, she is met with a scary prophecy... *Warning: Strong language! * COMPLETED
MISTRESS OF FLAME by CeCeLib
82 parts Complete
[ BOOK 1 OF AZITERA: YTHER'S QUEEN ] Consumed by avarice, the four human kingdoms-the Infernal Empire, the Kingdom of Caelum, the Kingdom of Treterra, and the Nayale Archipelago-betrayed their covenant with Yther of Azitera, the race blessed by deities, who protected humans for untold centuries. They slaughtered and defiled the beings that once protected them from storm, famine, poverty, and pestilence without mercy. Betrayed by the humans they protected, the Ytherians were enslaved. Their four queens were caged, chained, and imprisoned to serve as nutrients to the human kingdoms. The once prominent Ytherians were reduced to nothing but servants. As the four kingdoms of the human race prospered for many years since their betrayal, one news staggered them, causing them to tremble in fear and rally their armies to protect and defend their domain: Sollel-the Mistress of Flame, one of Yther's queens-had escaped her prison. Her flames will raze hell, ready to burn the souls of her betrayers. COMPLETED CECELIB | C.C. COVER: ASTRID JAYDEE
Mój Arcyklejnot by Majcia1015
118 parts Complete
Kontynuacja książki 'Forever Together'. Smaug nie żyje, podobnie jak Azog, Góra została odzyskana, a krasnoludy wreszcie są w domu. Arissa i Thorin rozpoczynają nowy rozdział w życiu jako władcy Ereboru i przywracają królestwu dawną świetność. Wszystko super świetnie, gdyby nie pewien gość z przeszłości dziewczyny, wiele nieodkrytych tajemnic i ktoś, kto pragnie zemsty za śmierć Bladego Orka. Opowieść o lojalności, niezwykłej przyjaźni oraz nieskończonej miłości... Okładka stworzona przez wspaniałą @Oli122002 ❤
(FINISHED)Lesbian/Bisexual Oneshots(Gay/lesbian) by _Anxiety_sucks_
200 parts Complete
REQUESTS ARE CLOSED AS THIS BOOK IS FINISHED PLEASE LOOK AT AT SECOND ONESHOT BOOKS IF YOU WANT TO REQUEST A CHARACTER. So since I love so many female characters I decided to write a oneshots book because I've read to many of them and because I can't find many with female character x fem reader so here you are my own oneshots book! I will do Lesbian and Bisexual oneshots NO LEMONS/SMUTS because they make me uncomfortable to write, just fluff and angst This oneshots book is now completed, I will start making a second book!
The Lost Queen (Book 1 of The Lost Queen Series) by stephsaige
59 parts Complete
A human seer and an elven prince have one thing in common: a missing sister. Seraiah's dreams have a habit of coming true, but when all her dreams turn into nightmares, she fears for her sister's life. Each nightmare is a little different, but they always end the same way--with something else looking out from Sterling's eyes. When Sterling is kidnapped, Seraiah suspects the worst. After their father refuses to search for Sterling, Seraiah is forced to take matters into her own hands. She accepts the help of elven prince, Kaimana, who bears an uncanny resemblance to Sterling, and his Commander, Kestrel. Together, this unlikely trio will have to race against time to find Sterling before it's too late. ===================================================================== This is Book 1 in an Upper YA/NA Fantasy series told through multiple point of views. If you like magic, elves, faeries, and dragons with a touch of romance, this book might be for you. Cover commissioned from GetCovers. A Wattpad Featured Story on 9/8/17 First place winner for Action/Fantasy in the Apollo Awards Second place winner for Fantasy in The Mystical Awards for September
Dragon: New Dad's Daily Life (Chapter 1-110) by TriangularPyramid2
60 parts Ongoing
This is from my deleted account. I'm the Translator. He was just a top student in the veterinary medicine department from the Agricultural University. Before he could even realize his dream, on a stormy night, he was summoned to another world by a certain Dragon King. From then on, the cute little dragon cubs and the sick magical beasts all flocked to him.
You may also like
Slide 1 of 8
Zrozumieć miłość cover
What if Cale turned into a child? (Trash of the Count's Family Fanfiction) cover
Claimed By Darkness cover
MISTRESS OF FLAME cover
Mój Arcyklejnot cover
(FINISHED)Lesbian/Bisexual Oneshots(Gay/lesbian) cover
The Lost Queen (Book 1 of The Lost Queen Series) cover
Dragon: New Dad's Daily Life (Chapter 1-110) cover

Zrozumieć miłość

37 parts Complete

"Miłość sama w sobie jest nie do pojęcia, ale dzięki miłości możemy pojąć wszystko..." Lairiel za wszelką cenę chce naprawić błędy z przeszłości i zrekompensować krasnoludom doznane przykrości ze strony jej ludzi. Nie spodziewała się jednak, że Gandalf znajdzie rozwiązanie jej problemu w taki sposób. Lairiel kryje w sobie wiele tajemnic, których nie jest gotowa wyjawić kompanii. Czy wśród swoich towarzyszy znajdzie kogoś, kto myślałby jak ona i potrafił ją zrozumieć...?

More details