𝗧𝗵𝗲 𝗗𝗲𝘃𝗶𝗹'𝘀 𝗖𝗿𝗼𝘄𝗻
talesofdevil
  • Reads 168,174
  • Votes 9,943
  • Parts 14
  • Time 3h 34m
  • Reads 168,174
  • Votes 9,943
  • Parts 14
  • Time 3h 34m
talesofdevil
Ongoing, First published Jul 27
Mature
3 new parts
darkromancehotindiaindianloveatfirstsightmafiaminemystery-thrillerpopularpossesiveromancerussiarussianteenfictionwattpadyoungadult
A devil rules a land of sin, whose soil whispers forbiddance. Zyran didn't know the meaning of desire being burned and one forced to be quiet. Until she came meandering into his land. All he wanted was her the moment she came before his eyes.

A mistake of hers. According to him. 

Until he knew her biggest mistake. Her still loving her dead husband.

"You are mine, no matter what." He say out loud for her to hear.

"I am a widow." She again presses on the same thing. 

He smile at her, "A fucking cherry on the cake."

Dark romance| 18+
All Rights Reserved
darkromancehotindiaindianloveatfirstsightmafiaminemystery-thrillerpopularpossesiveromancerussiarussianteenfictionwattpadyoungadult
Table of contents

14 parts

Sign up to add 𝗧𝗵𝗲 𝗗𝗲𝘃𝗶𝗹'𝘀 𝗖𝗿𝗼𝘄𝗻 to your library and receive updates
or
Content Guidelines
You may also like
My Little Doom by rkive_imagine
67 parts Ongoing Mature
Book one of the annihilation series Jeon Min-ho, a name whispered with a mix of dread and respect in the dark alleys of the underworld. He is the epitome of power, a Mafia king whose mere presence commands silence. His lineage is one of blood and honor, tracing back to a legacy crafted by his father and uncle. Min-ho, however, is not just a successor; he is an empire builder, a man who carved his path with a charisma as lethal as his force. His handsome visage is but a deceptive veil over the iron will within. Noor Singh, a princess not just by birth but by spirit, radiates a charm that belies her resilience. Her world shattered when assassins, cold and calculating, took from her what she held dear. In the aftermath, she finds herself a pawn in a game of power, her captors seeking to barter her life for peace with Min-ho. But they underestimated her; she is no mere token to be traded. The assassins' intrusion into Min-ho's domain was a fatal error, a challenge to his authority he cannot ignore. A meeting is set, not for negotiation but for retribution. Yet, amidst the shadow of death, a glimmer of beauty captures Min-ho's hardened heart. Noor, even in her battered state, is a vision that ensnares him. A decision is made: she will be his, but not as a gift from trembling foes. He will claim her as his own after he delivers justice in its most final form. But Noor is no damsel in distress, and Min-ho will soon discover that the fiercest battles come from within. For Noor's spirit is unyielding; she bows to no one. Their worlds collide, a tumultuous clash of wills, and from this storm, a question arises: Can the Mafia king win the heart of the indomitable princess, or will she be the queen to checkmate the king? This tale of power, passion, and defiance is just beginning, and only time will tell how it will unfold. The game is set, the players ready, and the world watches with bated breath as destiny plays its hand.
"Dear Brother" ~Kny x demon reader~ by Fir3fly-16
21 parts Ongoing
❝We too have a bond, and it's not only tied by the blood we were born with.❞ As a member of the Spider family you too were given a role, and that role was decided since the day your younger brother Rui was born. Once your parents died you were left taking care of a demon child as you prevented death from separating the two of you. . . . . "...lower moon 5? How odd, I thought he was dead" -Started: |August 18 2023|- -Finished:|- - - | -
𝙏𝙊𝙐𝘾𝙃 𝙏𝘼𝙉𝙆, 𝙤𝙨𝙘𝙖𝙧 𝙥𝙞𝙖𝙨𝙩𝙧𝙞 by imissthegirlyouwere
16 parts Ongoing
𝙫𝙞𝙚𝙣𝙣𝙖 𝙡𝙞𝙫𝙚𝙙 𝙖 𝙗𝙤𝙧𝙞𝙣𝙜 𝙨𝙞𝙢𝙥𝙡𝙚 𝙡𝙞𝙛𝙚 𝙖𝙨 𝙖 𝙨𝙢𝙖𝙡𝙡 𝙘𝙤𝙣𝙩𝙚𝙣𝙩 𝙘𝙧𝙚𝙖𝙩𝙤𝙧. 𝙪𝙣𝙩𝙞𝙡 𝙨𝙝𝙚 𝙢𝙚𝙩 𝙤𝙨𝙘𝙖𝙧 𝙥𝙞𝙖𝙨𝙩𝙧𝙞 𝙖𝙣𝙙 𝙝𝙚𝙧 𝙡𝙞𝙛𝙚 𝙬𝙖𝙨 𝙣𝙤 𝙡𝙤𝙣𝙜𝙚𝙧 𝙗𝙤𝙧𝙞𝙣𝙜 𝙖𝙣𝙙 𝙨𝙞𝙢𝙥𝙡𝙚. book 2 of my lyrics series
Flowers and Jeans [Modern Day Levi x OC] by citrustae
21 parts Complete
Iris Hamilton has moved schools four times because of being bullied constantly and getting into several fights. She also is a discipline problem for the teachers with her attitude and what they call back talking. Why wouldn't she move? This time though, Iris tries something different. This time, she promises that she's going to try to make friends. She's going to try to last the rest of the year. She's going to try to be good. She's going to try to start over and change her ways. Maybe. How well will that turn out with a stupid boy named after a pair of jeans annoying her every day? Will she be able to last the rest of the year? Or will she have to move once again? DISCLAIMER I do not own any Attack on Titan characters and I do not own the show.
In The Hands of Dominic by Penglowy
26 parts Ongoing
The last thing that feisty Andra, a tomboy, expects from her father is to be forced into a marriage with Dominic, a handsome and resilient stranger who becomes a threat to her wayward lifestyle with his formidable disposition. NOTE: This story was formerly known as "Wedded To A Stranger"
𝐑𝐨𝐲𝐚𝐥 𝐖𝐡𝐢𝐬𝐩𝐞𝐫- 𝐓𝐚𝐥𝐞 𝐎𝐟 𝐅𝐨𝐫𝐛𝐢𝐝𝐝𝐞𝐧 𝐎𝐛𝐬𝐞𝐬𝐬𝐢𝐨𝐧 by liyahheavennzz
8 parts Ongoing Mature
𝐓𝐡𝐞 𝐑𝐨𝐲𝐚𝐥 𝐖𝐡𝐢𝐬𝐩𝐞𝐫- 𝐓𝐚𝐥𝐞 𝐎𝐟 𝐅𝐨𝐫𝐛𝐢𝐝𝐝𝐞𝐧 𝐎𝐛𝐬𝐞𝐬𝐬𝐢𝐨𝐧
𝐈𝐧𝐟𝐞𝐥𝐢𝐜𝐢𝐭𝐨𝐮𝐬 𝐋𝐨𝐯𝐞 by author_sambhavi
15 parts Ongoing Mature
𝐁𝐎𝐎𝐊 𝟏 𝐎𝐅 𝐋𝐎𝐕𝐄 𝐒𝐄𝐑𝐈𝐄𝐒!!! [𝐃𝐚𝐫𝐤 𝐑𝐨𝐦𝐚𝐧𝐜𝐞] 𝐕𝐞𝐞𝐫 𝐗 𝐀𝐝𝐢𝐭𝐢 "So you want to be my wife?" He asked pinning her to the wall. "Yes!" She managed to say this to him with a slight smile on her face. "Ok then, sell your company to me!" He said with a smirk. "Wh..what? How can I?" She said with a confused face. "Or give whole of you to me for one night!" He said moving towards his chair. ⋇⋆✦⋆⋇　 🄰🄳🄸🅃🄸 🅂🄷🄴🄺🄷🄰🅆🄰🅃 CEO of Shekhawat enterprises. She is a self built female and started loving veer from their first meet itself. She can go at any extent to get her love. She respects everyone in her company whether they are poor or rich and has no ego. She loves her sister Rhea so much! 🅅🄴🄴🅁 🅁🄰🄶🄷🅄🅅🄰🄽🅂🄷🄸 CEO of Raghuvanshi and Rawat enterprises. He is a cold and arrogant person who hates females due to his past. He wants to become the richest person in the world and that could be only possible by taking under him the most successful and richest company SHEKHAWAT ENTERPRISES. He loves his brother Aditya more than himself! What will happen with both of them, when they will get together? Or not? Aditi trusts Veer more than herself but what will happen when he will break her trust in one go? Can they be together or destiny has some other plans? Let's see what will happen with them! 💓 𝙽𝚘𝚝𝚎:- 𝚃𝚑𝚒𝚜 𝚗𝚘𝚟𝚎𝚕 𝚌𝚘𝚗𝚝𝚊𝚒𝚗𝚜 𝙷𝙸𝙶𝙷𝙻𝚈 𝙼𝙰𝚃𝚄𝚁𝙴 𝙲𝙾𝙽𝚃𝙴𝙽𝚃!!! 𝚁𝚎𝚊𝚍 𝚊𝚝 𝚢𝚘𝚞𝚛 𝚘𝚠𝚗 𝚛𝚒𝚜𝚔! Hello lovelies!! My another story! Hope you will give it all of your love ❤...
Ishq Ki Kahani by authorafrah
56 parts Complete
"Stop trying to act like my fiancée because I don't give a damn about you!" His words echoed through the room breaking my remaining hopes - Alizeh (The badass girl) gets tied in an arranged marriage to Zain (The reserved one) but he makes it very clear he wants nothing to do with her while she can't help falling for him. Alizeh X Zain : •Arranged Marriage • Forced Proximity • Grumpy X Sunshine ----------- "Go die!" I shouted "Dying for you is very easy Meri Jaan. I want to live, for you, with you. But if I ever have to live without you again I WILL die." He replied like he meant every word of it. - Dua (the heartbroken girl) comes across Azaan (the playboy) who broke her years ago. Now that they meet again he is determined to get her back but she isn't ready to give him another chance but a truth from the past crushes all their chances. Dua X Azaan • Second Chance • Soulmates • Forbidden Love ---------- "That rich brat-!" I was complaining to my friend when a voice interrupted me from behind "Yes, sweetheart" it was that rich brat winking at me. -Noor (the good girl) meets her perfect match Ahaan (the bad boy) who challenges her in everything. He doesn't care about anyone except her but she cares about everyone except him. Noor X Ahaan • Enemies to lovers • Fake Dating • Good girl X Bad boy ---------- "We are nothing to each other" I said "Yes we are, you're my future girlfriend" he replied flashing his brightest smile. -Shayra (The grumpy sarcastic one) comes across Kabir (The golden retriever). He is the one who can bring light to her darkness. He falls for her but she only pretends to fall. Shayra X Kabir •Reverse Grumpy X Sunshine • Love at First Sight * Office Romance --- The four best friends ( Alizeh, Dua, Noor and Shayra ) meet up after five years at a former classmate's wedding but this wedding turns out to be a life changer for all of them as they come across the Aziz brothers.
Nixon by KatGee
62 parts Complete Mature
Nixon is the 3rd book in the Broken Series. (Ryan is the 1st, Brynn is the 2nd) Nixon leaves rehab early because he can't deal with being there anymore. His sister Kelis finds someone in need of a roommate so he moves in with the girl and gives her his middle name, Lucas. He quickly becomes addicted to the girl and once he gets one taste he's done for. He warns her about his past, about his name, but she ignores all the red flags, not realizing exactly how intertwined she is with the people from his past. He becomes enamored with her, feels like she was made for him while still battling the demons of his past and soon it all becomes too much for him to handle. He makes a heartbreaking decision, thinking it's what's best for both of them and everything changes. Trigger/Content Warning: this book contains mature content, talks of suicide, mental and physical abuse, selfharm, drug use, and addiction Cover designed by Anastasia Wright
The Billionaire Wants Me Back |18+| by insertwritername
24 parts Ongoing Mature
Ivy Ivrine was betrayed by her billionaire boss and now that she wants nothing to do with him, he's back six years later and wants nothing but to have her as his own.
You may also like
Slide 1 of 10
My Little Doom cover
"Dear Brother" ~Kny x demon reader~ cover
𝙏𝙊𝙐𝘾𝙃 𝙏𝘼𝙉𝙆, 𝙤𝙨𝙘𝙖𝙧 𝙥𝙞𝙖𝙨𝙩��𝙧𝙞 cover
Flowers and Jeans [Modern Day Levi x OC] cover
In The Hands of Dominic cover
𝐑𝐨𝐲𝐚𝐥 𝐖𝐡𝐢𝐬𝐩𝐞𝐫- 𝐓𝐚𝐥𝐞 𝐎𝐟 𝐅𝐨𝐫𝐛𝐢𝐝𝐝𝐞𝐧 𝐎𝐛𝐬𝐞𝐬𝐬𝐢𝐨𝐧 cover
𝐈𝐧𝐟𝐞𝐥𝐢𝐜𝐢𝐭𝐨𝐮𝐬 𝐋𝐨𝐯𝐞 cover
Ishq Ki Kahani cover
Nixon cover
The Billionaire Wants Me Back |18+| cover

My Little Doom

67 parts Ongoing Mature

Book one of the annihilation series Jeon Min-ho, a name whispered with a mix of dread and respect in the dark alleys of the underworld. He is the epitome of power, a Mafia king whose mere presence commands silence. His lineage is one of blood and honor, tracing back to a legacy crafted by his father and uncle. Min-ho, however, is not just a successor; he is an empire builder, a man who carved his path with a charisma as lethal as his force. His handsome visage is but a deceptive veil over the iron will within. Noor Singh, a princess not just by birth but by spirit, radiates a charm that belies her resilience. Her world shattered when assassins, cold and calculating, took from her what she held dear. In the aftermath, she finds herself a pawn in a game of power, her captors seeking to barter her life for peace with Min-ho. But they underestimated her; she is no mere token to be traded. The assassins' intrusion into Min-ho's domain was a fatal error, a challenge to his authority he cannot ignore. A meeting is set, not for negotiation but for retribution. Yet, amidst the shadow of death, a glimmer of beauty captures Min-ho's hardened heart. Noor, even in her battered state, is a vision that ensnares him. A decision is made: she will be his, but not as a gift from trembling foes. He will claim her as his own after he delivers justice in its most final form. But Noor is no damsel in distress, and Min-ho will soon discover that the fiercest battles come from within. For Noor's spirit is unyielding; she bows to no one. Their worlds collide, a tumultuous clash of wills, and from this storm, a question arises: Can the Mafia king win the heart of the indomitable princess, or will she be the queen to checkmate the king? This tale of power, passion, and defiance is just beginning, and only time will tell how it will unfold. The game is set, the players ready, and the world watches with bated breath as destiny plays its hand.

More details