Valley Girl (A Stardew story)
Squishy790
  • Reads 188
  • Votes 7
  • Parts 5
  • Time 1h 11m
  • Reads 188
  • Votes 7
  • Parts 5
  • Time 1h 11m
Squishy790
Ongoing, First published Jul 28
enemiestoloversfanfictionfarmerhaleyhaleystardewvalleyhaleyxfarmerqueerhaleyromancestardewstardewvalleyvalley
Haley thinks highly of herself and doesn't take kindly to people hurting the people she cared for. That includes the local farmer that she befriended. she doesn't know how to handle when he passes and his granddaughter, that abandoned him, shows up trying to take his place in the community. 


Write's notes: 
I always thought there could be more context to why Haley was so mean to the new farmer other than just - mean girl. Here is a starting idea. The lays a foundation. Please excuse and grammatical or spelling errors. Thank you!
All Rights Reserved
enemiestoloversfanfictionfarmerhaleyhaleystardewvalleyhaleyxfarmerqueerhaleyromancestardewstardewvalleyvalley
Table of contents

5 parts

Sign up to add Valley Girl (A Stardew story) to your library and receive updates
or
#46valley
Content Guidelines
You may also like
The QB Bad Boy: Playing for Keeps by tayxwriter
51 parts Complete
As Dallas and Drayton navigate life in the spotlight, Spencer is navigating intense feelings for Nathan - her best friend's brother. ***** Dallas and Drayton are planning their wedding, talking babies and learning how to navigate life in LA now that Drayton is a hotshot football player in the big leagues. Meanwhile, Spencer and Nathan are back at home in Colorado, coming to terms with their feelings for one another and learning how to co-parent with Grayson, the father of Spencer's daughter. Will the realities of adult life strengthen them - or will their relationships break? [Sequel to The QB Bad Boy and Me] [[word count: 150,000-200,000 words]]
MISTRESS OF FLAME by CeCeLib
82 parts Complete
[ BOOK 1 OF AZITERA: YTHER'S QUEEN ] Consumed by avarice, the four human kingdoms-the Infernal Empire, the Kingdom of Caelum, the Kingdom of Treterra, and the Nayale Archipelago-betrayed their covenant with Yther of Azitera, the race blessed by deities, who protected humans for untold centuries. They slaughtered and defiled the beings that once protected them from storm, famine, poverty, and pestilence without mercy. Betrayed by the humans they protected, the Ytherians were enslaved. Their four queens were caged, chained, and imprisoned to serve as nutrients to the human kingdoms. The once prominent Ytherians were reduced to nothing but servants. As the four kingdoms of the human race prospered for many years since their betrayal, one news staggered them, causing them to tremble in fear and rally their armies to protect and defend their domain: Sollel-the Mistress of Flame, one of Yther's queens-had escaped her prison. Her flames will raze hell, ready to burn the souls of her betrayers. COMPLETED CECELIB | C.C. COVER: ASTRID JAYDEE
Isolated (Stardew Valley) by deceiviing
23 parts Complete
As June settles back into Pelican Town for a fresh start, she expects a calm and peaceful life devoid of any haunting memories from the city. Little does she expect the secrets lurking within the Valley, along with the mysterious dark haired boy who keeps himself isolated from everything; that is, until her. ★ This story is a first person female narrative! The amazing artwork of Sebastian in the cover is NOT created by me (credit to @blacktreecle on Twitter!!!) Other artwork linked in the chapters belong to their rightful owners.
The Farmer Wife by Specgalz
61 parts Ongoing
Title: Farmer's Wife ( 農婦) Author: Jin Chai Twelve ( 金釵十二) Another MTL-ing but if someone already upload it , I left it alone Synopsis to the work: Traverse to the farmhouse, marry an ancient simple and honest man, and also give birth to a small meaty bun, let's see her use her knowledge to make a fortune and raise a bun.
The Boy Next Door by discoverhope
25 parts Complete
Hayden Willis had become used to her pampered life in New York, but all that's about to change after her mom marries a farmer from middle-of-nowhere Kansas. Hayden leaves the only home she's ever known, her friends, her boyfriend, and her city lifestyle, and everything absolutely sucks about her new home... Except for the Wyatt Cooper, the cute boy next door.
Ace by antoniawritess
100 parts Complete Mature
[COMPLETE][EDITING] Ace Hernandez, the Mafia King, known as the Devil. Sofia Diaz, known as an angel. The two are arranged to be married, forced by their fathers, joining the two Mafia's. But Sofia eventually learns, even the devil was once an angel. Cover by @alluringathena *This book is more of a romance book than Mafia book and I hope you enjoyyy*
Hired To Love by JordanLynde
66 parts Complete Mature
Henley agrees to pretend to date millionaire Bennett Calloway for a fee, falling in love as she wonders - how is he involved in her brother's false conviction? ****** Henley Linden's brother is in jail for a crime he didn't commit, and she'll take any job to raise the money needed to free him. Soon, she's agreed to pretend to date millionaire Bennett Calloway for ten thousand dollars, so his mother will ease up the pressure on him to find a wife. But once Henley is enmeshed in Bennett's world, he falls for her, and she starts to have feelings for him as well. Despite her romance with Bennett, as she grows closer to the Calloways, Henley realizes they are somehow involved in her brother's conviction. Journeying deeper into a world of wealth and conspiracies, Henley is forced to rely on Bennett, though doing so could cost her everything. [[word count: 200,000-250,000 words]]
Eighty Cannon Fodder Turns Over 1-199 by MarivelGregorio
200 parts Ongoing
brief introduction: Lin Susu was reborn. This time, she must be filial to her grandmother and keep the bracelet handed down from her ancestors. There will be grievances and revenge. Many enemies? It doesn't matter, she will look for them one by one. Cousin, scumbag, scumbag's woman, scum grandpa... Lin Susu will never let go. The space in the silver bracelet is gone? It doesn't matter, the girl has hands and feet, she will definitely live better than her last life. Brother soldier, what are you doing with this girl? This girl doesn't believe in love at first sight, let alone goodbye. With my treasure hunting attributes, I don't need a man to reach the pinnacle of life. A certain military officer: I have seen you do evil in my previous life, so I have to take care of you in this life and don't accept any explanation... Author: Yueer in the Forest Category: Modern Romance Status: serializing Words: 2.04 million Click: 682
Stardew Valley OneShots by Bizzbell
15 parts Complete
A small collection of oneshots I made a long time ago during my humble writing beginnings :)
You may also like
Slide 1 of 9
The QB Bad Boy: Playing for Keeps cover
MISTRESS OF FLAME cover
Isolated (Stardew Valley) cover
The Farmer Wife cover
The Boy Next Door cover
Ace cover
Hired To Love cover
Eighty Cannon Fodder Turns Over 1-199 cover
Stardew Valley OneShots cover

The QB Bad Boy: Playing for Keeps

51 parts Complete

As Dallas and Drayton navigate life in the spotlight, Spencer is navigating intense feelings for Nathan - her best friend's brother. ***** Dallas and Drayton are planning their wedding, talking babies and learning how to navigate life in LA now that Drayton is a hotshot football player in the big leagues. Meanwhile, Spencer and Nathan are back at home in Colorado, coming to terms with their feelings for one another and learning how to co-parent with Grayson, the father of Spencer's daughter. Will the realities of adult life strengthen them - or will their relationships break? [Sequel to The QB Bad Boy and Me] [[word count: 150,000-200,000 words]]

More details